Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

2 accessions found for Proteus mirabilis HI4320  

Data for AM942759  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AM942759.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM942759_3536 CDS_3897519-3895690 69.4 3.2e-20 1
AM942759_0191 CDS_230249-228702 60.3 1.6e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM942759_3536 1/1 398 466 .. 1 70 [] 69.4 3.2e-20
AM942759_0191 1/1 315 380 .. 1 70 [] 60.3 1.6e-17

Alignments of top-scoring domains:
AM942759_3536: domain 1 of 1, from 398 to 466: score 69.4, E = 3.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IARELHDs++QsLs +k+q++ ++++ ++ p+ ++ l+e+
AM942759_3 398 ERSAIARELHDSIAQSLSCLKMQVSYLQMQS--ETLPDNCQKLLKEM 442

relarealaevRrllgdLR.paal<-*
re ++ a++++R+ll+++R ++
AM942759_3 443 REELNVAYRQLRELLTTFRlKLTE 466

AM942759_0191: domain 1 of 1, from 315 to 380: score 60.3, E = 1.6e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+ IARELHD++gQ+++ai +q+ l++r + d d + r+ ++i
AM942759_0 315 VKKAIARELHDEIGQNITAIQIQSMLVKRSA--DND--KTRQSGEQI 357

relarealaevRrllgdLRpaal<-*
++la++ + +R+ll++LRp++l
AM942759_0 358 ERLAQQIHQSTRQLLRQLRPPIL 380


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 34 0|===
-13 110 0|=========
-12 185 40|===*===========
-11 316 330|=========================*
-10 680 767|===================================================== *
-9 712 871|======================================================= *
-8 513 671|======================================== *
-7 375 422|============================= *
-6 256 238|==================*=
-5 201 128|=========*======
-4 106 66|=====*===
-3 52 34|==*=
-2 24 17|=*
-1 21 8|*=
0 14 4|*=
1 2 2|*
2 1 1|*
3 1 0|=
4 1 0|=
5 0 0|
> 6 3 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 695.0963
P(chi-square) = 0

Total sequences searched: 3685

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: