hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AP003017.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP003017_0152 CDS_146860-147987 89.5 1.4e-26 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP003017_0152 1/1 181 268 .. 1 94 [] 89.5 1.4e-26
Alignments of top-scoring domains:
AP003017_0152: domain 1 of 1, from 181 to 268: score 89.5, E = 1.4e-26
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRVKNNLQ+I++L+rL++r++ +++ ++ ++ +RV +
AP003017_0 181 ELQHRVKNNLQMITALIRLETRNAAEPD------QKRFERLAGRVDA 221
mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
A++++ L+ e d +d++ Yl+ +++ + s++v++++++ k+D+
AP003017_0 222 LAILYQALSNDEQSDEIDLGIYLSQIASAVMASHAVEGIRLDMKVDT 268
Histogram of all scores:
score obs exp (one = represents 2 sequences)
----- --- ---
-15 2 0|=
-14 0 0|
-13 12 1|*=====
-12 18 13|======*==
-11 62 38|==================*============
-10 35 49|================== *
-9 30 41|=============== *
-8 26 28|=============*
-7 8 16|==== *
-6 7 9|====*
-5 3 4|=*
> -4 6 -|===
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 28.8611
P(chi-square) = 6.463e-05
Total sequences searched: 209
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K