Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Mesorhizobium loti MAFF303099  

Data for AP003017  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AP003017.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP003017_0151 CDS_145810-146850 146.0 7.4e-51 1
AP003017_0077 CDS_69291-67219 142.3 1.4e-49 1
AP003017_0129 CDS_128341-126527 135.2 3.6e-47 1
AP003017_0071 CDS_59525-60535 106.5 2e-37 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP003017_0151 1/1 151 233 .. 1 85 [] 146.0 7.4e-51
AP003017_0077 1/1 494 574 .. 1 85 [] 142.3 1.4e-49
AP003017_0129 1/1 409 489 .. 1 85 [] 135.2 3.6e-47
AP003017_0071 1/1 142 230 .. 1 85 [] 106.5 2e-37

Alignments of top-scoring domains:
AP003017_0151: domain 1 of 1, from 151 to 233: score 146.0, E = 7.4e-51
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+V +++ T+++++s+d+fv++Fs+R+++L+ +H++
AP003017_0 151 ELHHRVKNTLANVRAMMGATAKSSGSVDDFVRDFSARIVSLADTHSM 197

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt++ W++A+L++Lle+eL++y++ d+ R++l+GP+
AP003017_0 198 --LTDDYWQMASLHKLLESELRHYDTSDRSRVVLEGPN 233

AP003017_0077: domain 1 of 1, from 494 to 574: score 142.3, E = 1.4e-49
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLAvVQ+ia QT Rna+sl+e+ ++++ RL++Ls aHd+
AP003017_0 494 ELNHRVKNTLAVVQAIASQTIRNATSLPEAGRTLTSRLVSLSKAHDI 540

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+ +W+gA L++L+ + + P+++ eR++++G+
AP003017_0 541 --LTQKNWSGANLHDLIIESIKPHAA--IERFQITGEK 574

AP003017_0129: domain 1 of 1, from 409 to 489: score 135.2, E = 3.6e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+nHRVKN+ +v+ S++r T+++++++++f +++++R++ALsr+HdL
AP003017_0 409 EVNHRVKNQYSVILSMIRETNKRSETPKQFEAQVRQRIMALSRSHDL 455

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ ++W gA++reLl+a+ +P+ +e i +sGP+
AP003017_0 456 --LVSADWKGATIRELLAAQAQPFPR--GEMIDMSGPS 489

AP003017_0071: domain 1 of 1, from 142 to 230: score 106.5, E = 2e-37
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HRVKN+L++ +++ + T+R++++ +++++ +++RL AL+raHdL
AP003017_0 142 EMSHRVKNLLTIASGLTAITSRSTTTTNDMARELTQRLTALGRAHDL 188

V.p.LtrseWagAdLreLleaeLaPygged..aeRitlsGPd<-*
V+p ++e+a+A L++Ll+ LaPy++ + ++Ri++s P+
AP003017_0 189 VrPvPGQTEAASALLGDLLTVLLAPYDDLGafSGRIRVSVPR 230


Histogram of all scores:
score obs exp (one = represents 1 sequences)
----- --- ---
-14 1 0|=
-13 10 0|==========
-12 27 0|===========================
-11 29 1|*============================
-10 33 21|====================*============
-9 37 53|===================================== *
-8 29 55|============================= *
-7 16 37|================ *
-6 5 20|===== *
-5 7 10|======= *
-4 5 4|===*=
> -3 10 -|==========


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 48.4655
P(chi-square) = 2.854e-09

Total sequences searched: 209

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: