Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Magnetospirillum magneticum AMB-1  

Data for AP007255  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AP007255.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP007255_3917 CDS_4330599-4332242 123.3 7.5e-35 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP007255_3917 1/1 361 449 .. 1 94 [] 123.3 7.5e-35

Alignments of top-scoring domains:
AP007255_3917: domain 1 of 1, from 361 to 449: score 123.3, E = 7.5e-35
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQvISSLL +Q+ ++de+v +e L+++ +R+ S
AP007255_3 361 EVHHRVKNNLQVISSLLTMQSLHVTDEKV-----KETLKDALDRIHS 402

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m l+H+ LY+ ++vd++ Y+ kL+e L sy+ + +g+ +++++
AP007255_3 403 MGLVHQTLYERNLASNVDLGTYFGKLAEALAGSYASSPGGVTVEVEV 449


Histogram of all scores:
score obs exp (one = represents 21 sequences)
----- --- ---
-15 13 0|=
-14 39 0|==
-13 96 28|=*===
-12 281 299|==============*
-11 1224 833|=======================================*===================
-10 973 1079|=============================================== *
-9 743 911|==================================== *
-8 511 611|========================= *
-7 269 363|============= *
-6 213 202|=========*=
-5 87 108|=====*
-4 48 57|==*
-3 28 30|=*
-2 13 15|*
-1 6 8|*
0 6 4|*
1 5 2|*
> 2 4 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 433.4371
P(chi-square) = 0

Total sequences searched: 4559

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: