Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
7 projects found  

3 accessions found for Thermus thermophilus HB8  

Data for AP008226  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AP008226.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP008226_1181 CDS_1128143-1126596 92.0 3.8e-27 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP008226_1181 1/1 318 385 .. 1 70 [] 92.0 3.8e-27

Alignments of top-scoring domains:
AP008226_1181: domain 1 of 1, from 318 to 385: score 92.0, E = 3.8e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+++QsL+ ++l+l+l++rl +kd e+a al+e+
AP008226_1 318 ERTRIAREIHDGLAQSLAFMALKLDLVERLW--EKDKEAALGALAEV 362

relarealaevRrllgdLRpaal<-*
re++r ++evRr + +LRp +l
AP008226_1 363 RETLRAQIREVRRSIFALRPIDL 385


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 3 0|=
-13 12 0|==
-12 14 22|===*
-11 43 180|======== *
-10 175 419|============================== *
-9 225 476|====================================== *
-8 257 367|=========================================== *
-7 302 230|======================================*============
-6 265 130|=====================*=======================
-5 268 70|===========*=================================
-4 138 36|=====*=================
-3 98 18|==*==============
-2 62 9|=*=========
-1 40 4|*======
0 26 2|*====
1 17 1|*==
2 10 0|==
3 6 0|=
4 4 0|=
5 3 0|=
6 0 0|
7 1 0|=
8 1 0|=
9 0 0|
10 1 0|=
11 0 0|
12 0 0|
> 13 2 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2035.1917
P(chi-square) = 0

Total sequences searched: 1973

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: