Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

2 accessions found for Corynebacterium glutamicum R  

Data for AP009044  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AP009044.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP009044_1064 CDS_1158047-1159306 86.9 1.9e-25 1
AP009044_1872 CDS_2044007-2042856 76.1 2.8e-22 1
AP009044_2903 CDS_3158280-3156946 60.2 1.4e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP009044_1064 1/1 230 297 .. 1 70 [] 86.9 1.9e-25
AP009044_1872 1/1 183 248 .. 1 70 [] 76.1 2.8e-22
AP009044_2903 1/1 208 281 .. 1 70 [] 60.2 1.4e-17

Alignments of top-scoring domains:
AP009044_1064: domain 1 of 1, from 230 to 297: score 86.9, E = 1.9e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R A+ELHD++gQ+L+a+++++ela++l+ ++ +++++++l+e+
AP009044_1 230 ERLRFAQELHDTLGQHLAAMSVKSELALALA--KRGDDRLEKELREL 274

relarealaevRrllgdLRpaal<-*
++l r++++e+R++++++R+ l
AP009044_1 275 QKLTRTSMSEMRDVVSGYRTVNL 297

AP009044_1872: domain 1 of 1, from 183 to 248: score 76.1, E = 2.8e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIA E+HD+v+Q+Ls+i + l++a++++ d++ +a +++ +
AP009044_1 183 ERARIAGEIHDTVAQGLSSIQMLLHAAEKRV--DDP--QALSHIRLA 225

relarealaevRrllgdLRpaal<-*
r++ + lae+R+++ +L+p+ l
AP009044_1 226 RQTTADNLAETRQIIAALQPTPL 248

AP009044_2903: domain 1 of 1, from 208 to 281: score 60.2, E = 1.4e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrllds....dkdpeearea
ER+RIA E+HD+v+Q+Ls+i + l++ ++ + + ++k+ e++ +
AP009044_2 208 ERQRIAHEIHDTVAQGLSSIQMLLHVSEQEILVaemeEKPKEAIVKK 254

ldeirelarealaevRrllgdLRpaal<-*
++ +r++a++ l+e+R+++ +L+paal
AP009044_2 255 MRLARQTASDNLSEARAMIAALQPAAL 281


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 16 0|==
-13 60 0|======
-12 120 34|===*========
-11 167 279|================= *
-10 471 649|================================================ *
-9 559 737|======================================================== *
-8 485 568|================================================= *
-7 352 357|===================================*
-6 274 202|====================*=======
-5 255 108|==========*===============
-4 122 56|=====*=======
-3 72 29|==*=====
-2 40 14|=*==
-1 18 7|*=
0 19 3|*=
1 7 1|*
2 3 0|=
3 3 0|=
4 2 0|=
5 0 0|
6 1 0|=
> 7 6 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 785.4427
P(chi-square) = 0

Total sequences searched: 3052

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: