Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Kocuria rhizophila DC2201  

Data for AP009152  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AP009152.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP009152_2179 CDS_2508925-2507723 93.3 1.9e-27 1
AP009152_1663 CDS_1883478-1884749 85.2 4.5e-25 1
AP009152_2153 CDS_2480003-2481400 77.7 7.5e-23 1
AP009152_0715 CDS_779352-778012 71.8 4e-21 1
AP009152_0431 CDS_470740-469586 66.7 1.3e-19 1
AP009152_1632 CDS_1849402-1850922 63.8 9.5e-19 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP009152_2179 1/1 198 265 .. 1 70 [] 93.3 1.9e-27
AP009152_1663 1/1 215 282 .. 1 70 [] 85.2 4.5e-25
AP009152_2153 1/1 214 281 .. 1 70 [] 77.7 7.5e-23
AP009152_0715 1/1 188 255 .. 1 70 [] 71.8 4e-21
AP009152_0431 1/1 167 232 .. 1 70 [] 66.7 1.3e-19
AP009152_1632 1/1 207 275 .. 1 70 [] 63.8 9.5e-19

Alignments of top-scoring domains:
AP009152_2179: domain 1 of 1, from 198 to 265: score 93.3, E = 1.9e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD+v++sLs+++ q+++ar+++ + pe a e+l +i
AP009152_2 198 ERARIAREMHDVVAHSLSVVIAQADGARYAA--SSTPEVAVETLGTI 242

relarealaevRrllgdLRpaal<-*
+e+ar +lae+R llg+LR+ +
AP009152_2 243 AETARGSLAEMRKLLGVLRTEDG 265

AP009152_1663: domain 1 of 1, from 215 to 282: score 85.2, E = 4.5e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++ +a+ +q+++ar + ++dp++a+++l+ +
AP009152_1 215 ERLRIARELHDVVAHHVTAMGVQAGAARLSM--ARDPDAAAAHLRGV 259

relarealaevRrllgdLRpaal<-*
+ ar+a +e+ ++++LR++++
AP009152_1 260 ESSARDAVSELKTMVHTLRDGEE 282

AP009152_2153: domain 1 of 1, from 214 to 281: score 77.7, E = 7.5e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RI R+LHD+v +L ++++ l++a ++ d+dp++a++ ++e+
AP009152_2 214 ERSRIERDLHDGVQPQLVSVAMNLSMASSRI--DTDPAAAKQLVAEA 258

relarealaevRrllgdLRpaal<-*
+++ + a++e+Rrl+++++pa+l
AP009152_2 259 HGTTKAAITELRRLARGFHPAVL 281

AP009152_0715: domain 1 of 1, from 188 to 255: score 71.8, E = 4e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ R+ HD +g+sL++i+++++la+rl+ ++dp++a ++l +
AP009152_0 188 QREAVGRDVHDILGHSLTVITVKTQLAQRLV--ETDPQRAVAELNDV 232

relarealaevRrllgdLRpaal<-*
+l+real++vR ++g+LR+ +l
AP009152_0 233 LALSREALTDVRSTVGRLRDLDL 255

AP009152_0431: domain 1 of 1, from 167 to 232: score 66.7, E = 1.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +AR+LHD+v++ L+++++q+ + +r ++dpee+ +++d++
AP009152_0 167 ERLALARDLHDVVAHELTLVTMQAAGSQR----QSDPEELHRTIDTM 209

relarealaevRrllgdLRpaal<-*
++ar +l+e+R ll+ LR++
AP009152_0 210 DTAARSGLTELRTLLHILRDSPG 232

AP009152_1632: domain 1 of 1, from 207 to 275: score 63.8, E = 9.5e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++RE+HD+++Q+L++i l + +a+++l+ +++ + a+++l++i
AP009152_1 207 ERERLSREIHDTLAQGLTSIVLVSRAAQQALE-RDERDVAAARLATI 252

relarealaevRrllgdLRpaal<-*
+++a lae+Rr ++dL +al
AP009152_1 253 EDTAAANLAEARRFVRDLASPAL 275


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-14 5 0|=
-13 17 0|===
-12 32 26|===*=
-11 71 216|=========== *
-10 224 501|================================ *
-9 371 569|===================================================== *
-8 350 438|================================================== *
-7 362 275|=======================================*============
-6 255 156|======================*==============
-5 278 83|===========*============================
-4 156 43|======*================
-3 88 22|===*=========
-2 66 11|=*========
-1 19 5|*==
0 17 2|*==
1 9 1|*=
2 17 0|===
3 7 0|=
4 4 0|=
5 1 0|=
6 0 0|
> 7 8 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1647.2603
P(chi-square) = 0

Total sequences searched: 2357

Whole sequence top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: