Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
25 projects found  

1 accessions found for Gemmatimonas aurantiaca T-27  

Data for AP009153  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AP009153.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP009153_3206 CDS_3795391-3796392 143.9 9.2e-41 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP009153_3206 1/1 138 224 .. 1 94 [] 143.9 9.2e-41

Alignments of top-scoring domains:
AP009153_3206: domain 1 of 1, from 138 to 224: score 143.9, E = 9.2e-41
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNL+vISSLL +Q+ +++d e+ +L+Esq+RV+S
AP009153_3 138 EIHHRVKNNLAVISSLLYMQSTRITDLET-----TTVLEESQRRVRS 179

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE LY+s++l++v+f++Y L+e+ ++s + ++ i+++ l
AP009153_3 180 MALVHETLYRSGNLSSVEFADYAASLCEEVRHSQRIPGQSIEFD--L 224


Histogram of all scores:
score obs exp (one = represents 18 sequences)
----- --- ---
-15 3 0|=
-14 11 0|=
-13 48 24|=*=
-12 233 258|============= *
-11 1009 719|=======================================*=================
-10 919 931|===================================================*
-9 649 786|===================================== *
-8 504 527|============================ *
-7 207 313|============ *
-6 180 174|=========*
-5 73 94|=====*
-4 50 49|==*
-3 21 26|=*
-2 13 13|*
-1 8 7|*
0 5 3|*
1 0 1|*
> 2 2 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 208.4137
P(chi-square) = 5.956e-38

Total sequences searched: 3935

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: