Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
25 projects found  

1 accessions found for Gemmatimonas aurantiaca T-27  

Data for AP009153  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AP009153.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP009153_3313 CDS_3925101-3927377 84.4 1.3e-24 1
AP009153_0415 CDS_476282-474606 65.0 6.9e-19 1
AP009153_2231 CDS_2621920-2619890 59.4 3.1e-17 1
AP009153_3407 CDS_4019821-4019210 45.8 3.1e-13 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP009153_3313 1/1 549 616 .. 1 70 [] 84.4 1.3e-24
AP009153_0415 1/1 362 429 .. 1 70 [] 65.0 6.9e-19
AP009153_2231 1/1 474 538 .. 1 70 [] 59.4 3.1e-17
AP009153_3407 1/1 103 170 .. 1 70 [] 45.8 3.1e-13

Alignments of top-scoring domains:
AP009153_3313: domain 1 of 1, from 549 to 616: score 84.4, E = 1.3e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD++ Q++++i+lql++++ ++ + p++a + l++i
AP009153_3 549 ERSRIARELHDTLLQGFTGITLQLQAVQGQI--QQSPAQASDSLERI 593

relarealaevRrllgdLRpaal<-*
+ a+ al+e+R +++d+R ++l
AP009153_3 594 LTQADGALREARTMVWDIRAPEL 616

AP009153_0415: domain 1 of 1, from 362 to 429: score 65.0, E = 6.9e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER++IARELHD+ gQ+L ++kl l+++ r+l ++d + +r+ lde+
AP009153_0 362 ERQHIARELHDEAGQALVGVKLALQVLSRVL--PSDTPHVRAPLDEL 406

relarealaevRrllgdLRpaal<-*
r +++a a R+l+++LRp+al
AP009153_0 407 RLQVNQATARFRQLARRLRPPAL 429

AP009153_2231: domain 1 of 1, from 474 to 538: score 59.4, E = 3.1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++RELHD+ +Q +sa+k+qle +r + ++ +ld++
AP009153_2 474 ERRRLSRELHDETAQVFSAVKMQLESLR-----PLLAADSSPRLDRL 515

relarealaevRrllgdLRpaal<-*
l+++++a +R++ ++LRp+ l
AP009153_2 516 LSLVDTGIASIRQVTSALRPTLL 538

AP009153_3407: domain 1 of 1, from 103 to 170: score 45.8, E = 3.1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARELHD + Q + +++ +l+++r ll +++p++a ld
AP009153_3 103 ERSRMARELHDRLLQEFQGLMFHLQAVRDLL--PDEPGRAVPVLDLT 147

relarealaevRrllgdLRpaal<-*
++e ++e+R ++g+LR ++
AP009153_3 148 LLKGEEVIDEARKAVGELRSSEQ 170


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 5 0|=
-13 28 0|===
-12 73 43|===*===
-11 109 360|========== *
-10 360 836|================================= *
-9 609 950|======================================================== *
-8 584 732|====================================================== *
-7 566 460|=========================================*==========
-6 456 260|=======================*==================
-5 444 139|============*============================
-4 228 72|======*==============
-3 187 37|===*=============
-2 98 19|=*=======
-1 72 9|*======
0 45 4|*====
1 27 2|*==
2 15 1|*=
3 8 0|=
4 8 0|=
5 5 0|=
6 1 0|=
7 0 0|
8 1 0|=
9 0 0|
> 10 6 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 3097.5413
P(chi-square) = 0

Total sequences searched: 3935

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: