hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AP009179.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP009179_2038 CDS_2116055-2117908 87.1 8.4e-25 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP009179_2038 1/1 430 518 .. 1 94 [] 87.1 8.4e-25
Alignments of top-scoring domains:
AP009179_2038: domain 1 of 1, from 430 to 518: score 87.1, E = 8.4e-25
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+I S+LrLQ + ++++e+ + L ++RV +
AP009179_2 430 EIHHRVKNNLQIILSMLRLQNDEIDNPEI-----NDKLTNLEQRVNA 471
mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A ++ +L +++l+++++++Y+e L+ ++ ++y+ + ++is + D+
AP009179_2 472 IAKTYMMLLSTDNLERINMKPYIETLLLDISEAYNFRYHHISTSTDI 518
Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-15 2 0|=
-14 4 0|=
-13 16 15|=*
-12 90 160|========= *
-11 542 445|============================================*==========
-10 473 577|================================================ *
-9 467 487|=============================================== *
-8 332 326|================================*=
-7 188 194|===================*
-6 177 108|==========*=======
-5 51 58|=====*
-4 42 30|==*==
-3 33 16|=*==
-2 10 8|*
-1 5 4|*
0 2 2|*
1 1 1|*
> 2 3 -|=
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 137.8572
P(chi-square) = 4.441e-24
Total sequences searched: 2466
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K