Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Bifidobacterium adolescentis ATCC 15703  

Data for AP009256  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AP009256.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP009256_0606 CDS_761379-758770 101.9 3.8e-30 2
AP009256_1041 CDS_1294008-1292794 67.7 4.8e-20 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP009256_0606 1/2 242 309 .. 1 70 [] 79.6 1.4e-23
AP009256_1041 1/1 188 257 .. 1 70 [] 67.7 4.8e-20

Alignments of top-scoring domains:
AP009256_0606: domain 1 of 2, from 242 to 309: score 79.6, E = 1.4e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR++HD+v+++Ls i++q+++ r++ + dp+ ar ++++i
AP009256_0 242 ERARIARDMHDVVAHTLSIIIVQSDGGRYAG--THDPAVARNTMETI 286

relarealaevRrllgdLRpaal<-*
r+ +++al ++ rllg++ + +
AP009256_0 287 RHESERALHDMQRLLGVFGGSPH 309

AP009256_1041: domain 1 of 1, from 188 to 257: score 67.7, E = 4.8e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD vg++L+ +++q+e+a+ +++ + e+ ++++ ei
AP009256_1 188 ERTRIAREIHDNVGHMLTRAIMQTEAAHVVAQ-VAGQEQSAQRFCEI 233

relarealaevRrllgdLR.paal<-*
+++++ea++ vR +++dL++++++
AP009256_1 234 HDTVSEAMTLVRKAVHDLKdEGTD 257


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 3 0|=
-13 15 0|===
-12 35 18|==*===
-11 78 149|============= *
-10 214 346|==================================== *
-9 331 393|======================================================== *
-8 250 303|========================================== *
-7 197 190|===============================*=
-6 151 108|=================*========
-5 161 57|=========*=================
-4 78 30|====*========
-3 54 15|==*======
-2 29 7|=*===
-1 10 4|*=
0 5 2|*
1 7 1|*=
2 2 0|=
3 3 0|=
4 3 0|=
5 0 0|
6 1 0|=
7 0 0|
> 8 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 546.9169
P(chi-square) = 0

Total sequences searched: 1631

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: