Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Streptomyces griseus subsp. griseus NBRC 13350  

Data for AP009493  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AP009493.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP009493_4104 CDS_4797756-4798958 100.8 3.4e-29 1
AP009493_5124 CDS_6039299-6037950 95.3 1.5e-27 1
AP009493_3911 CDS_4599385-4598066 91.1 2.5e-26 1
AP009493_6997 CDS_8397961-8399256 88.7 1.3e-25 1
AP009493_5343 CDS_6287846-6289123 88.4 1.6e-25 1
AP009493_2249 CDS_2664989-2666254 88.3 1.7e-25 1
AP009493_3410 CDS_3996866-3995526 86.5 5.8e-25 1
AP009493_1853 CDS_2202537-2203811 86.1 7.5e-25 1
AP009493_4385 CDS_5123407-5124747 84.8 1.8e-24 1
AP009493_5694 CDS_6672851-6673996 80.0 4.7e-23 1
AP009493_0884 CDS_1038115-1039125 79.9 5.3e-23 1
AP009493_6268 CDS_7449975-7448782 78.4 1.4e-22 1
AP009493_6945 CDS_8336938-8338122 77.0 3.8e-22 1
AP009493_5300 CDS_6244526-6243258 75.2 1.2e-21 1
AP009493_4043 CDS_4732259-4731066 75.1 1.3e-21 1
AP009493_3864 CDS_4530360-4529008 71.6 1.4e-20 1
AP009493_2158 CDS_2557721-2558965 70.8 2.5e-20 1
AP009493_1293 CDS_1516849-1518048 69.1 7.7e-20 1
AP009493_1281 CDS_1506567-1505347 68.9 8.8e-20 1
AP009493_0205 CDS_211151-209967 67.9 1.8e-19 1
AP009493_1438 CDS_1677911-1676679 66.1 6.1e-19 1
AP009493_0875 CDS_1028520-1027234 60.1 3.5e-17 1
AP009493_3234 CDS_3757638-3758918 58.4 1.2e-16 1
AP009493_4840 CDS_5693377-5694870 56.5 4e-16 1
AP009493_2926 CDS_3421473-3422660 56.1 5.3e-16 1
AP009493_3297 CDS_3863091-3864977 55.8 6.5e-16 1
AP009493_2927 CDS_3422888-3424261 55.2 9.8e-16 1
AP009493_2524 CDS_2981857-2980391 53.8 2.5e-15 1
AP009493_3643 CDS_4258506-4256800 51.3 1.4e-14 1
AP009493_3259 CDS_3781860-3783101 50.4 2.5e-14 1
AP009493_2949 CDS_3442985-3444166 49.8 3.8e-14 1
AP009493_5093 CDS_6007733-6006123 46.9 2.8e-13 1
AP009493_2842 CDS_3344687-3345895 34.0 1.7e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP009493_4104 1/1 189 256 .. 1 70 [] 100.8 3.4e-29
AP009493_5124 1/1 229 297 .. 1 70 [] 95.3 1.5e-27
AP009493_3911 1/1 227 294 .. 1 70 [] 91.1 2.5e-26
AP009493_6997 1/1 209 276 .. 1 70 [] 88.7 1.3e-25
AP009493_5343 1/1 198 265 .. 1 70 [] 88.4 1.6e-25
AP009493_2249 1/1 210 277 .. 1 70 [] 88.3 1.7e-25
AP009493_3410 1/1 217 284 .. 1 70 [] 86.5 5.8e-25
AP009493_1853 1/1 215 282 .. 1 70 [] 86.1 7.5e-25
AP009493_4385 1/1 211 278 .. 1 70 [] 84.8 1.8e-24
AP009493_5694 1/1 183 250 .. 1 70 [] 80.0 4.7e-23
AP009493_0884 1/1 141 205 .. 1 70 [] 79.9 5.3e-23
AP009493_6268 1/1 190 255 .. 1 70 [] 78.4 1.4e-22
AP009493_6945 1/1 186 254 .. 1 70 [] 77.0 3.8e-22
AP009493_5300 1/1 231 298 .. 1 70 [] 75.2 1.2e-21
AP009493_4043 1/1 179 246 .. 1 70 [] 75.1 1.3e-21
AP009493_3864 1/1 224 291 .. 1 70 [] 71.6 1.4e-20
AP009493_2158 1/1 190 255 .. 1 70 [] 70.8 2.5e-20
AP009493_1293 1/1 191 257 .. 1 70 [] 69.1 7.7e-20
AP009493_1281 1/1 201 269 .. 1 70 [] 68.9 8.8e-20
AP009493_0205 1/1 198 258 .. 1 63 [. 67.9 1.8e-19
AP009493_1438 1/1 217 284 .. 1 70 [] 66.1 6.1e-19
AP009493_0875 1/1 221 286 .. 1 70 [] 60.1 3.5e-17
AP009493_3234 1/1 204 269 .. 1 70 [] 58.4 1.2e-16
AP009493_4840 1/1 141 207 .. 1 70 [] 56.5 4e-16
AP009493_2926 1/1 197 264 .. 1 70 [] 56.1 5.3e-16
AP009493_3297 1/1 185 252 .. 1 70 [] 55.8 6.5e-16
AP009493_2927 1/1 267 334 .. 1 70 [] 55.2 9.8e-16
AP009493_2524 1/1 233 302 .. 1 70 [] 53.8 2.5e-15
AP009493_3643 1/1 366 432 .. 1 70 [] 51.3 1.4e-14
AP009493_3259 1/1 188 255 .. 1 70 [] 50.4 2.5e-14
AP009493_2949 1/1 197 267 .. 1 70 [] 49.8 3.8e-14
AP009493_5093 1/1 343 431 .. 1 70 [] 46.9 2.8e-13
AP009493_2842 1/1 187 253 .. 1 63 [. 34.0 1.7e-09

Alignments of top-scoring domains:
AP009493_4104: domain 1 of 1, from 189 to 256: score 100.8, E = 3.4e-29
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v+++ s++ +q+++a++++ d++p++ar+al++i
AP009493_4 189 ERARIARELHDVVAHNVSVMVVQADGAAYVM--DAAPDQARQALETI 233

relarealaevRrllgdLRpaal<-*
++r+alae+Rrllg+LR+++
AP009493_4 234 SSTGRQALAEMRRLLGVLRTGDA 256

AP009493_5124: domain 1 of 1, from 229 to 297: score 95.3, E = 1.5e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v++++s+i++q++ a +++ p++are+++ i
AP009493_5 229 ERTRIARELHDVVAHHMSVITVQADSAPYRI--SGLPDPAREEFASI 273

relarealaevRrllgdLR.paal<-*
+++are+l e+Rrll++LR+++++
AP009493_5 274 AAAARESLGEMRRLLSVLRsDGTE 297

AP009493_3911: domain 1 of 1, from 227 to 294: score 91.1, E = 2.5e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD +g++Ls+i+ +++ ++++ +k+pe+a +al++i
AP009493_3 227 ERTRIAREMHDIIGHNLSVITSLADGGAYAA--RKNPERAGQALEAI 271

relarealaevRrllgdLRpaal<-*
+++r+al+e+Rrllg+LR+a+
AP009493_3 272 GATSRQALSELRRLLGVLRDAGA 294

AP009493_6997: domain 1 of 1, from 209 to 276: score 88.7, E = 1.3e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v++++s+i++q+++a +++ +++p e +al+ i
AP009493_6 209 ERARIARELHDVVAHHMSVISIQADAAPYRV--ADPPREMVTALTDI 253

relarealaevRrllgdLRpaal<-*
r+ a e+l+e+Rrllg+LR ++
AP009493_6 254 RAGALEGLDELRRLLGVLRSEGH 276

AP009493_5343: domain 1 of 1, from 198 to 265: score 88.4, E = 1.6e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD+v+++++++++q+++a++++ d+ p++a+eal+ +
AP009493_5 198 ERLRIARDLHDVVAHHIALVNVQAGVAAHVM--DRRPDQAKEALAHV 242

relarealaevRrllgdLRpaal<-*
r+++r al+e+R ++g LR +++
AP009493_5 243 RDASRSALNELRVTVGLLRQQGD 265

AP009493_2249: domain 1 of 1, from 210 to 277: score 88.3, E = 1.7e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v++++s+i++q+++a +l+ + + ee+re l+ i
AP009493_2 210 ERGRIARELHDVVAHHMSVISIQAQVAPHLV--EHPTEELRENLAGI 254

relarealaevRrllgdLRpaal<-*
re a ealae+Rr+lg+LR
AP009493_2 255 RENALEALAELRRVLGVLRSESA 277

AP009493_3410: domain 1 of 1, from 217 to 284: score 86.5, E = 5.8e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHD+v++++s++++q+e+a +++ + +p+e+++a+ +i
AP009493_3 217 ERTTIARELHDVVAHHMSVVAIQAEAAPYRV--ENPPPELEQAFVTI 261

relarealaevRrllgdLRpaal<-*
re a al+e+Rr+lg+ R +
AP009493_3 262 RENAVAALTELRRVLGVVRAEDY 284

AP009493_1853: domain 1 of 1, from 215 to 282: score 86.1, E = 7.5e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHD +++s s+i++ +e a + + ++ ++ar+a++ei
AP009493_1 215 ERAAIARELHDMIAHSVSVIAVRAESATYTT--PDLSPPARDAFQEI 259

relarealaevRrllgdLRpaal<-*
+++ar ++ae+Rrllg+LR+++
AP009493_1 260 AGTARASMAELRRLLGVLRTGDG 282

AP009493_4385: domain 1 of 1, from 211 to 278: score 84.8, E = 1.8e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+v+++ s++ +++ ++++++ +kdp++a + ++ +
AP009493_4 211 ERTRIAREMHDVVAHRVSLMVVHAAALQAVA--PKDPAKAVRNAALV 255

relarealaevRrllgdLRpaal<-*
+++r+al+e+R++lg+LR+++
AP009493_4 256 GDMGRQALTELREMLGVLRTGDA 278

AP009493_5694: domain 1 of 1, from 183 to 250: score 80.0, E = 4.7e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+A ELHD v+Q L++++l +++a +l+ d+dp++a+ +l+++
AP009493_5 183 ERSRLAHELHDAVSQKLFSLRLTAQAATALV--DRDPARAKGELQQV 227

relarealaevRrllgdLRpaal<-*
++la ea +e+R+++ +LRpaal
AP009493_5 228 AALAAEAVDELRAAVVELRPAAL 250

AP009493_0884: domain 1 of 1, from 141 to 205: score 79.9, E = 5.3e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R A+ELHD+vgQ+L+a+ l l +++ d +pe++re+l+++
AP009493_0 141 ERRRVAQELHDEVGQTLTAVLLELKRVA-----DHAPEPLREELRQV 182

relarealaevRrllgdLRpaal<-*
+e+ r +l+e+Rr++++LRp++l
AP009493_0 183 QEITRGSLDEIRRIARRLRPGVL 205

AP009493_6268: domain 1 of 1, from 190 to 255: score 78.4, E = 1.4e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHDs+g++L+++ +q+++ar+ + dp+ ++al++i
AP009493_6 190 ERNRMARELHDSIGHALTVAVVQAGAARA----ANDPAFTERALAAI 232

relarealaevRrllgdLRpaal<-*
+e++r+al+++ r+l++LR+++
AP009493_6 233 EETGRDALEDLERVLRVLRESGT 255

AP009493_6945: domain 1 of 1, from 186 to 254: score 77.0, E = 3.8e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++++++s++++q++++ ++ d +ee r ++ i
AP009493_6 186 ERNRIAREMHDVLAHRISLVAMQAGVLDHRG--DLGAEESRLLVRGI 230

relarealaevRrllgdLR.paal<-*
+e +++al+e+R++lg+LR ++++
AP009493_6 231 AEGSHQALEELRDVLGVLRaDPGH 254

AP009493_5300: domain 1 of 1, from 231 to 298: score 75.2, E = 1.2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+ + l+++++l+ +kdp++a++ l+++
AP009493_5 231 ELRRIERDLHDGAQARLVAMGMNLGTIEALI--EKDPARAKKMLAMA 275

relarealaevRrllgdLRpaal<-*
re + eal+e+R+l+++++p++l
AP009493_5 276 RESSAEALTELRDLVRGIHPPVL 298

AP009493_4043: domain 1 of 1, from 179 to 246: score 75.1, E = 1.3e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++ E+HD+++Q+Ls+ + l++a r +dpe+ar++++++
AP009493_4 179 ERQRLSMEIHDTLAQGLSSQQMLLQAADRTW--GADPEAARRHVRTA 223

relarealaevRrllgdLRpaal<-*
++a++ lae+Rr ++dL pa+l
AP009493_4 224 TGIAERNLAEARRFVHDLAPADL 246

AP009493_3864: domain 1 of 1, from 224 to 291: score 71.6, E = 1.4e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R R++HD++g +Ls+i+l++ela l+ ++ +++a +++ e+
AP009493_3 224 ERLRFGRDMHDVLGRNLSVIALKSELAVELA--QRGNPAAMDQMVEV 268

relarealaevRrllgdLRpaal<-*
+++ar +++evR++++++R+a+l
AP009493_3 269 QRIARASQQEVRDVVRGYREADL 291

AP009493_2158: domain 1 of 1, from 190 to 255: score 70.8, E = 2.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD v+ +Lsa+++++ +a+ + +dp+ r al+ i
AP009493_2 190 ERARMARELHDMVANHLSAVAIHSTAAL-SI---DDPDTSRNALRVI 232

relarealaevRrllgdLRpaal<-*
re + e+lae+Rrl+g LR++++
AP009493_2 233 RENSVEGLAEMRRLIGLLREGGE 255

AP009493_1293: domain 1 of 1, from 191 to 257: score 69.1, E = 7.7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+R+ARE+HD+++Q+Ls+i l l +a+ ++ pe+ +a+++++
AP009493_1 191 ERERLAREIHDTLAQGLSSIQLLLRAAE-----RSLPEeaPAAAHVR 232

eirelarealaevRrllgdLRpaal<-*
++re+a+ lae+R +++L p++l
AP009493_1 233 AAREAAQANLAEARSFVRALTPPDL 257

AP009493_1281: domain 1 of 1, from 201 to 269: score 68.9, E = 8.8e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IARE+HD+++++L+++++++++++ + d++++e+ +a+ i
AP009493_1 201 AREAIAREMHDVLAHRLTLLSVHAGALEFRP--DAPAAEVGRAAGVI 245

relarealaevRrllgdLR.paal<-*
r+ a+eal+++R+++g+LR+p++
AP009493_1 246 RDSAHEALQDLREIIGVLRgPGDT 269

AP009493_0205: domain 1 of 1, from 198 to 258: score 67.9, E = 1.8e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q++++i + +e+ar l ++dp+ ++l +i
AP009493_0 198 ERERLAREIHDTLAQGFASIVVLAEAARSGL--ATDPGTSGKHLLAI 242

relarealaevRrllg<-*
+ +are lae+R l+g
AP009493_0 243 ENTARENLAEARVLVG 258

AP009493_1438: domain 1 of 1, from 217 to 284: score 66.1, E = 6.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ ++ a+++ ++ a++ll d+dp++ar++lde+
AP009493_1 217 ELRRIERDLHDGAQARIVALSMRIGIAKQLL--DRDPAAARARLDEA 261

relarealaevRrllgdLRpaal<-*
++ a+ alae+R+++++++p++l
AP009493_1 262 QDGAEAALAELRHVVRGIHPPVL 284

AP009493_0875: domain 1 of 1, from 221 to 286: score 60.1, E = 3.5e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HD+v+Q L++++ ql+++ d ++p+ +r +++++
AP009493_0 221 ERRRLAAEIHDTVAQDLTGVISQLQVVT---D-SREPDTVRVHAERA 263

relarealaevRrllgdLRpaal<-*
+lar++l e+Rr++ +L p al
AP009493_0 264 LQLARHSLGEARRAVVNLAPVAL 286

AP009493_3234: domain 1 of 1, from 204 to 269: score 58.4, E = 1.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L a+++ l+lar +++++++ ld++
AP009493_3 204 ERRRIERDLHDGAQQRLVALSMTLGLARL----ERPAGPLGGLLDRA 246

relarealaevRrllgdLRpaal<-*
+e a+ al e+R+l+++++p +l
AP009493_3 247 HEEASAALVEIRELIHGIHPHIL 269

AP009493_4840: domain 1 of 1, from 141 to 207: score 56.5, E = 4e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR++HD++g+ Ls+i+l +++++ l+ + +e+ r+a++ i
AP009493_4 141 ERARIARDMHDVLGHDLSLIALSAGALK-LA--PGLDERHRRAAQDI 184

relarealaevRrllgdLRpaal<-*
r+ a a + + +++g+LR+ +
AP009493_4 185 RGRAGAAVERLGEVIGVLREESE 207

AP009493_2926: domain 1 of 1, from 197 to 264: score 56.1, E = 5.3e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+RI R+LHD+ +L a++++l+la+ l ++dpe+a++ +de+
AP009493_2 197 DLRRIERDLHDGAQARLVALAMGLGLAKEKL--TDDPEAAARMVDEA 241

relarealaevRrllgdLRpaal<-*
++ ++ al+e+R+l+++++pa+l
AP009493_2 242 HGEIKVALQELRDLARGIHPAVL 264

AP009493_3297: domain 1 of 1, from 185 to 252: score 55.8, E = 6.5e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IA ++HDs+g++Ls+++l +++++ l ++ ++ r+ l e+
AP009493_3 185 ERAGIAADMHDSLGHALSLVALRAGALE-LS--PDLTDRDRADLSEL 228

relarealaevRrllgdLR.paal<-*
r+++ +a +++R+++ +L++p++
AP009493_3 229 RGTIADAVEQLRDTVAVLHdPPDG 252

AP009493_2927: domain 1 of 1, from 267 to 334: score 55.2, E = 9.8e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+RI R+LHD+ +L a+++ l+la+ l ++dpe+a++ +de+
AP009493_2 267 DLRRIERDLHDGAQARLVALAMDLGLAKEKL--ADDPEAAARMVDEA 311

relarealaevRrllgdLRpaal<-*
++ ++ al+e+R+l+++++pa+l
AP009493_2 312 HGEVKVALQELRDLARGIHPAVL 334

AP009493_2524: domain 1 of 1, from 233 to 302: score 53.8, E = 2.5e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HDsv+ +L +++l +++++ +d + +p+ ++ +++ +
AP009493_2 233 ERTRLAREMHDSVAKTLHGLALAADGLAGSAD-RMEPATVKLQAELV 278

relarealaevRrllgdLR.paal<-*
+++ar+a ae R+ll+dLR++++l
AP009493_2 279 ARAARRAAAESRELLSDLRrEQGL 302

AP009493_3643: domain 1 of 1, from 366 to 432: score 51.3, E = 1.4e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a ++le a+r+ + e+r+ + ++
AP009493_3 366 DRDRIARDLHDLVIQRLFATGMMLESAQRRS--VVP--EVRTGVGRA 408

relarealaevRrllgdLR.paal<-*
++ ++ +++e+R ++ +L++++a+
AP009493_3 409 ADELDVTIQEIRTAIFALQqEPAE 432

AP009493_3259: domain 1 of 1, from 188 to 255: score 50.4, E = 2.5e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R +A +LHD v++ s+i + +++a+ + ++ pe++ l++i
AP009493_3 188 QRLQLAADLHDFVAHDVSGIVVLAQAAQVIG--ADRPEQVLPLLQQI 232

relarealaevRrllgdLRpaal<-*
++ +r+al + r+++ LR ++
AP009493_3 233 EASGRQALGSMDRTVHMLRSSDG 255

AP009493_2949: domain 1 of 1, from 197 to 267: score 49.8, E = 3.8e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpeearealde
ER+RI R+LHD+ Q L a+ + l++++++++s ++d e++ + ++e
AP009493_2 197 ERQRIERDLHDGAQQELVAVVMRLGMLEAAATSaATDRERVVRLARE 243

irelarealaevRrllgdLRpaal<-*
+++ a++al+ +R++++d++p +l
AP009493_2 244 AQAQAERALERLRETVRDIHPREL 267

AP009493_5093: domain 1 of 1, from 343 to 431: score 46.9, E = 2.8e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.........
R RIAR+LHD v Q+L+a ++le rr++ +++ ++++++ +
AP009493_5 343 DRDRIARDLHDLVVQRLFATEMMLESTRRRA--TSAEAgghgeaaag 387

...........earealdeirelarealaevRrllgdLR.paal<-*
+++ + ++++ ea e l ++ + ++ +++evR ++ +L++p+a
AP009493_5 388 ggevearggevEAGELLGRAVDELDSTIQEVRTAIFALQqPPAG 431

AP009493_2842: domain 1 of 1, from 187 to 253: score 34.0, E = 1.7e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.....dkdpeeare
ERaR+ ++LHD vg sL+ai lq e+a+r ++++++ +pe+ar
AP009493_2 187 ERARMQQDLHDLVGSSLTAIVLQGEVALRGG-GtpdspSPAPERARG 232

aldeirelarealaevRrllg<-*
al+ei +lar+ ++vR + +
AP009493_2 233 ALTEIIALARRLHDDVRSISR 253


Histogram of all scores:
score obs exp (one = represents 18 sequences)
----- --- ---
-15 1 0|=
-14 8 0|=
-13 43 1|*==
-12 94 79|====*=
-11 179 654|========== *
-10 568 1517|================================ *
-9 1033 1723|==========================================================*
-8 981 1328|======================================================= *
-7 1051 835|==============================================*============
-6 904 472|==========================*========================
-5 897 253|==============*===================================
-4 509 132|=======*=====================
-3 313 68|===*==============
-2 222 34|=*===========
-1 111 17|*======
0 63 8|*===
1 42 4|*==
2 32 2|*=
3 10 1|*
4 15 0|=
5 8 0|=
6 1 0|=
7 8 0|=
8 4 0|=
9 2 0|=
10 2 0|=
11 0 0|
> 12 35 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 7170.3711
P(chi-square) = 0

Total sequences searched: 7138

Whole sequence top hits:
tophits_s report:
Total hits: 33
Satisfying E cutoff: 33
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 33
Satisfying E cutoff: 33
Total memory: 32K


Acknowledgements:

This research is funded by:

Developed by: