Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

5 accessions found for Sphingobium japonicum UT26S  

Data for AP010803  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AP010803.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP010803_3251 CDS_3231429-3233996 109.2 4.2e-37 1
AP010803_0799 CDS_812512-814035 77.0 3.9e-26 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP010803_3251 1/1 527 609 .. 1 85 [] 109.2 4.2e-37
AP010803_0799 1/1 308 396 .. 1 85 [] 77.0 3.9e-26

Alignments of top-scoring domains:
AP010803_3251: domain 1 of 1, from 527 to 609: score 109.2, E = 4.2e-37
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRV+N+L+++ ++ QT+ na+s+d+f ++++ R +AL+raHd+
AP010803_3 527 ELNHRVRNILSLIRGLLSQTRDNAQSVDQFIDTLESRVHALARAHDQ 573

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t ++Wa+A+L +L+e e a+y ge ++R+ l+GP+
AP010803_3 574 --ITADRWAPARLYDLIEVESAAYLGERRDRVKLTGPN 609

AP010803_0799: domain 1 of 1, from 308 to 396: score 77.0, E = 3.9e-26
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KN+++v+++++ ++R+++++ + ++++++R++AL+raHd
AP010803_0 308 ELSHRIKNIFSVISGLIGLSARQHPEIRAVADDLRDRIMALGRAHDF 354

V.p...LtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
V+p+++ ++ + + ++L +le+ +aPy+++ ++Ri++sG++
AP010803_0 355 VrPhgpNSQPDKGEGRLWGILEQIFAPYRDALGPRIHFSGDN 396


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 12 0|==
-13 70 0|=======
-12 300 0|============================
-11 389 28|==*=================================
-10 496 364|=================================*============
-9 595 903|======================================================= *
-8 613 937|======================================================== *
-7 431 629|======================================== *
-6 244 343|======================= *
-5 160 170|===============*
-4 75 80|=======*
-3 62 37|===*==
-2 39 17|=*==
-1 20 7|*=
0 11 3|*
1 3 1|*
2 1 0|=
3 1 0|=
4 0 0|
> 5 7 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4917.2920
P(chi-square) = 0

Total sequences searched: 3529

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: