Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

3 accessions found for Desulfovibrio magneticus RS-1  

Data for AP010904  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AP010904.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP010904_4458 CDS_5055274-5057388 137.2 8.7e-39 1
AP010904_2566 CDS_2866301-2864268 135.7 2.3e-38 1
AP010904_0178 CDS_182985-184973 131.5 3.6e-37 1
AP010904_1092 CDS_1209351-1208260 112.4 9.9e-32 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP010904_4458 1/1 510 595 .. 1 94 [] 137.2 8.7e-39
AP010904_2566 1/1 481 562 .. 1 94 [] 135.7 2.3e-38
AP010904_0178 1/1 472 553 .. 1 94 [] 131.5 3.6e-37
AP010904_1092 1/1 163 251 .. 1 94 [] 112.4 9.9e-32

Alignments of top-scoring domains:
AP010904_4458: domain 1 of 1, from 510 to 595: score 137.2, E = 8.7e-39
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+ISSLL LQa++++d+ + le +r s+nR++S
AP010904_4 510 EVHHRVKNNLQIISSLLYLQAEQVDDPVA-----LESFRVSRNRIAS 551

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HEe Y+s dl ++ ++ Y++ L+ +f g g+ + +D+
AP010904_4 552 MALVHEEIYRSADLARIRLDNYIRDLLPKIFGQVGQGAP---VAVDC 595

AP010904_2566: domain 1 of 1, from 481 to 562: score 135.7, E = 2.3e-38
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+ISSLL LQ + +d+ + aL+Es+nR++S
AP010904_2 481 EVHHRVKNNLQIISSLLFLQKDAMSDPVL-----QGALEESRNRIAS 522

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeLY+s+dl +vd++eYle+L+ ++ ++ ++ +
AP010904_2 523 MALIHEELYRSGDLARVDIKEYLERLAPKVVHALRGAKS-------V 562

AP010904_0178: domain 1 of 1, from 472 to 553: score 131.5, E = 3.6e-37
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQvISSL LQa+ + + e+ +e+L Es+ RV+S
AP010904_0 472 EVHHRVKNNLQVISSLFFLQAEVTNNAEA-----REVLLESRARVAS 513

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE LY+++d++++++s+Y+++Lt++L +s g++++ +
AP010904_0 514 MALVHEGLYRTGDFGRIELSDYVSRLTHQLESSIGGRDG-------V 553

AP010904_1092: domain 1 of 1, from 163 to 251: score 112.4, E = 9.9e-32
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+I +L+ +Qa+ +++ + +e + + RV+S
AP010904_1 163 EIHHRVKNNLQIILGLVAIQAEEADSDAE-----RERFSRLETRVRS 204

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliH++LYk +dl+t+d++eY + L+++L +++ g+++ +D+
AP010904_1 205 MALIHQQLYKHGDLSTIDMAEYAQALISSLAAIFRHAMAGVEVICDC 251


Histogram of all scores:
score obs exp (one = represents 21 sequences)
----- --- ---
-15 11 0|=
-14 32 0|==
-13 67 28|=*==
-12 348 304|==============*==
-11 1225 846|========================================*==================
-10 1016 1095|================================================= *
-9 713 925|================================== *
-8 554 620|=========================== *
-7 257 368|============= *
-6 221 205|=========*=
-5 69 110|==== *
-4 55 58|==*
-3 26 30|=*
-2 12 16|*
-1 11 8|*
0 2 4|*
1 5 2|*
2 0 1|*
3 0 0|
> 4 5 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 340.5035
P(chi-square) = 0

Total sequences searched: 4629

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: