Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

7 accessions found for Azospirillum sp. B510  

Data for AP010946  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AP010946.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP010946_0205 CDS_222131-223882 108.0 1.1e-30 1
AP010946_1655 CDS_1888166-1889890 91.2 6.8e-26 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP010946_0205 1/1 376 461 .. 1 94 [] 108.0 1.1e-30
AP010946_1655 1/1 378 460 .. 1 94 [] 91.2 6.8e-26

Alignments of top-scoring domains:
AP010946_0205: domain 1 of 1, from 376 to 461: score 108.0, E = 1.1e-30
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRVKNNLQvI SLLrLQa ++++++ + + Es +R+++
AP010946_0 376 EVQHRVKNNLQVICSLLRLQAARIDERA------RRGFDESLRRIQT 416

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+HE L++se+ ++f++ l+ +++ L +s + + +++L+
AP010946_0 417 MSLLHELLHRSEEPAHINFADALRQMCDGLVRSDNPTAARLELE--A 461

AP010946_1655: domain 1 of 1, from 378 to 460: score 91.2, E = 6.8e-26
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
IHHRVKNNLQvI SLL LQa+++ +e + + E+ R+ +
AP010946_1 378 DIHHRVKNNLQVILSLLELQAQRV--PEL-----EAPFGEALTRINT 417

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m liHE+ Y++ +++ v+++ ++ L+e+L + +++ + i +
AP010946_1 418 MGLIHEQIYRTTGVSAVELDNFVAALAEHLNSFHSRPGRTIV----I 460


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-15 2 0|=
-14 11 0|=
-13 47 18|=*==
-12 194 190|=============*
-11 783 529|=====================================*==================
-10 650 684|=============================================== *
-9 436 578|================================ *
-8 326 387|======================== *
-7 166 230|============ *
-6 149 128|=========*=
-5 53 69|====*
-4 32 36|==*
-3 28 19|=*
-2 6 10|*
-1 6 5|*
0 0 2|*
> 1 4 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 246.0947
P(chi-square) = 2.652e-315

Total sequences searched: 2893

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: