Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

7 accessions found for Azospirillum sp. B510  

Data for AP010947  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AP010947.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP010947_0581 CDS_730929-729433 150.5 1.1e-51 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP010947_0581 1/1 299 379 .. 1 85 [] 150.5 1.1e-51

Alignments of top-scoring domains:
AP010947_0581: domain 1 of 1, from 299 to 379: score 150.5, E = 1.1e-51
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQSiarQTlR a+s+++f +aF RL+AL++aHdL
AP010947_0 299 ELNHRVKNTLAMVQSIARQTLRAAPSVEAFPDAFQSRLRALAQAHDL 345

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W+gA+L+e+++ +L+P+ + a+R+++ GP+
AP010947_0 346 --LTRRHWQGASLSEIAALTLEPHVD--AGRVRVGGPP 379


Histogram of all scores:
score obs exp (one = represents 4 sequences)
----- --- ---
-13 4 0|=
-12 47 0|============
-11 72 9|==*===============
-10 154 116|============================*==========
-9 203 289|=================================================== *
-8 207 300|==================================================== *
-7 165 201|========================================== *
-6 112 110|===========================*
-5 69 54|=============*====
-4 45 25|======*=====
-3 23 12|==*===
-2 9 5|=*=
-1 7 2|*=
0 6 1|*=
1 5 0|==
2 0 0|
3 1 0|=
4 0 0|
> 5 2 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 529.6933
P(chi-square) = 0

Total sequences searched: 1131

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: