hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AP010948.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP010948_0297 CDS_325923-331040 134.1 8.8e-39 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP010948_0297 1/1 1506 1594 .. 1 94 [] 134.1 8.8e-39
Alignments of top-scoring domains:
AP010948_0297: domain 1 of 1, from 1506 to 1594: score 134.1, E = 8.8e-39
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+++SLL+LQ+r++kde+v +++ +s++RV+S
AP010948_0 1506 EIHHRVKNNLQLVTSLLNLQSRRIKDEAV-----AALFADSRDRVRS 1547
mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE LY+ +++ +v ++e le ++++L+++y++ ++ ++L++ l
AP010948_0 1548 MALVHESLYRLGNFARVPMREHLESVCAHLLRAYSRHAGSVRLEAGL 1594
Histogram of all scores:
score obs exp (one = represents 3 sequences)
----- --- ---
-13 4 3|*=
-12 31 41|=========== *
-11 169 115|======================================*==================
-10 150 149|=================================================*
-9 106 126|==================================== *
-8 80 84|===========================*
-7 33 50|=========== *
-6 35 27|========*===
-5 10 15|====*
-4 5 7|==*
-3 3 4|=*
-2 1 2|*
> -1 4 -|==
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 41.4964
P(chi-square) = 1.683e-06
Total sequences searched: 631
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K