Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

7 accessions found for Azospirillum sp. B510  

Data for AP010951  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AP010951.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP010951_0049 CDS_78705-75562 87.5 1.2e-30 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP010951_0049 1/1 850 930 .. 1 85 [] 87.5 1.2e-30

Alignments of top-scoring domains:
AP010951_0049: domain 1 of 1, from 850 to 930: score 87.5, E = 1.2e-30
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKN LAvV ++a+QTl+ a+ +e +aF gRLqA +++ dL
AP010951_0 850 ELDHRVKNMLAVVTALAQQTLKAIAEAPE-CTAFLGRLQAVASTYDL 895

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr+ W+ + L++++ e+ Py++ ++R+ ++GP+
AP010951_0 896 --LTRDGWGNVLLSDVVLNEVKPYATS-EGRFAVDGPA 930


Histogram of all scores:
score obs exp (one = represents 2 sequences)
----- --- ---
-14 1 0|=
-13 2 0|=
-12 26 0|=============
-11 26 3|=*===========
-10 41 42|====================*
-9 81 106|========================================= *
-8 70 110|=================================== *
-7 64 74|================================ *
-6 42 40|===================*=
-5 24 20|=========*==
-4 18 9|====*====
-3 9 4|=*===
-2 6 2|*==
> -1 5 -|===


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 30.6142
P(chi-square) = 3.003e-05

Total sequences searched: 415

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: