Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

6 accessions found for Rhodococcus opacus B4  

Data for AP011115  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AP011115.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP011115_0278 CDS_298519-297356 89.8 6.4e-26 1
AP011115_6530 CDS_7142266-7143462 80.9 2.7e-23 1
AP011115_6673 CDS_7292155-7290974 79.8 5.6e-23 1
AP011115_3840 CDS_4145663-4144422 77.1 3.6e-22 1
AP011115_6456 CDS_7071271-7072500 68.7 1.1e-19 1
AP011115_6120 CDS_6693218-6694558 62.9 5.3e-18 1
AP011115_6148 CDS_6725265-6726467 61.2 1.7e-17 1
AP011115_5315 CDS_5793401-5794741 60.6 2.5e-17 1
AP011115_1968 CDS_2102507-2104186 52.6 5.8e-15 1
AP011115_4128 CDS_4426685-4428646 48.1 1.2e-13 1
AP011115_0193 CDS_168009-169739 46.3 4.1e-13 1
AP011115_2375 CDS_2556058-2554517 40.8 1.8e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP011115_0278 1/1 185 252 .. 1 70 [] 89.8 6.4e-26
AP011115_6530 1/1 191 258 .. 1 70 [] 80.9 2.7e-23
AP011115_6673 1/1 187 254 .. 1 70 [] 79.8 5.6e-23
AP011115_3840 1/1 214 279 .. 1 70 [] 77.1 3.6e-22
AP011115_6456 1/1 195 263 .. 1 70 [] 68.7 1.1e-19
AP011115_6120 1/1 233 298 .. 1 70 [] 62.9 5.3e-18
AP011115_6148 1/1 194 265 .. 1 70 [] 61.2 1.7e-17
AP011115_5315 1/1 231 300 .. 1 70 [] 60.6 2.5e-17
AP011115_1968 1/1 366 433 .. 1 70 [] 52.6 5.8e-15
AP011115_4128 1/1 458 525 .. 1 70 [] 48.1 1.2e-13
AP011115_0193 1/1 385 450 .. 1 70 [] 46.3 4.1e-13
AP011115_2375 1/1 322 389 .. 1 70 [] 40.8 1.8e-11

Alignments of top-scoring domains:
AP011115_0278: domain 1 of 1, from 185 to 252: score 89.8, E = 6.4e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v+++ s++++q+++a ++l +++p+ a++al++i
AP011115_0 185 ERTRIARELHDVVAHAVSVMIVQADGASYAL--TSNPDIAKQALTNI 229

relarealaevRrllgdLRpaal<-*
+ ++realae+Rr+++ LR+
AP011115_0 230 ASTGREALAELRRTVSLLRTEPA 252

AP011115_6530: domain 1 of 1, from 191 to 258: score 80.9, E = 2.7e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E aRIAR+LHD+v++++s++ +q++ a +++ + +e r++++ i
AP011115_6 191 EKARIARDLHDVVAHHMSMVVVQAQSAPYRI--AGMSDETRAEFESI 235

relarealaevRrllgdLRpaal<-*
+++r al+evR llg+LR ++
AP011115_6 236 GAAGRAALNEVRGLLGVLRSDGQ 258

AP011115_6673: domain 1 of 1, from 187 to 254: score 79.8, E = 5.6e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IARELHD++++sLs+i++q+++a+ l d+ pe+ +eal +i
AP011115_6 187 ERLAIARELHDVLAHSLSLINVQASVALELW--DSRPEQSQEALSAI 231

relarealaevRrllgdLRpaal<-*
+ ++r+a+ +v +ll LR +
AP011115_6 232 KVASRDAIGDVHALLASLRGNDS 254

AP011115_3840: domain 1 of 1, from 214 to 279: score 77.1, E = 3.6e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+v+Q Ls+i + l++++r++ +++ +ar++++ +
AP011115_3 214 ERERLAREIHDTVAQDLSSIQMLLHAVERAA--PDH--PARDRIRLA 256

relarealaevRrllgdLRpaal<-*
re+a ++lae+R+l+gdL pa+l
AP011115_3 257 RETAADSLAETRQLIGDLTPAVL 279

AP011115_6456: domain 1 of 1, from 195 to 263: score 68.7, E = 1.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD v++++++i l +++a+++l ++ +++ r l+ +
AP011115_6 195 ERNALARELHDLVAHHMASIVLRIGVAQHVL--RDVDGPTRSVLEDV 239

relarealaevRrllgdLR.paal<-*
+++a++ala++Rrll +LR+p+
AP011115_6 240 HRTASDALADIRRLLVALRdPSMG 263

AP011115_6120: domain 1 of 1, from 233 to 298: score 62.9, E = 5.3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHDsv Q+ ++ +q+e++r + ++d e e+ld +
AP011115_6 233 ERHRIARELHDSVTQAVLSAGMQIEVCRSGV--PDD--ERSERLDLA 275

relarealaevRrllgdLRpaal<-*
+el r+a +++R ++ +L +++
AP011115_6 276 KELTRRAVEQLRSAIYALNHSGG 298

AP011115_6148: domain 1 of 1, from 194 to 265: score 61.2, E = 1.7e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe....earea
ER+R+ARE+HD+v Q+L++ l le+a+++ + ++++ + +are
AP011115_6 194 ERERLAREIHDTVTQGLTSSLLRLEAAEQIW--AQADPraeaRARED 238

ldeirelarealaevRrllgdLRpaal<-*
++ + +++re lae+R l+++L + l
AP011115_6 239 VRVATGTLRENLAETRSLVHHLAAPNL 265

AP011115_5315: domain 1 of 1, from 231 to 300: score 60.6, E = 2.5e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE HD++++sLs l+l +arr+l++d+d + a eal +
AP011115_5 231 ERQRIAREVHDVIAHSLSITLLHLTAARRALEQDRDVDDAVEALSDA 277

relarealaevRrllgdLRpaal<-*
++l+r+a+a++Rr++g L +
AP011115_5 278 ERLGRQAMADIRRTVGLLDAGPA 300

AP011115_1968: domain 1 of 1, from 366 to 433: score 52.6, E = 5.8e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a + l+ +++ + p+ +r ++++
AP011115_1 366 DRDRIARDLHDNVIQRLFATGMSLQSTHAVG---DVPDGVRSIVATA 409

relarealaevRrllgdLR.paal<-*
e ++++ +e+R ++ dL+ +++
AP011115_1 410 VEQLDRTVREIRTTIFDLQaTGVA 433

AP011115_4128: domain 1 of 1, from 458 to 525: score 48.1, E = 1.2e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ I RELHD++g sL++i+l+l++ar ll +dp +a+e +d++
AP011115_4 458 ERQMIRRELHDGLGPSLAGIRLGLQGARNLL--GSDPVAAAELIDAL 502

relarealaevRrllgdLRpaal<-*
+e +++ + vR+l + + p++l
AP011115_4 503 QEQLDHQVEGVRQLSRSMFPPVL 525

AP011115_0193: domain 1 of 1, from 385 to 450: score 46.3, E = 4.1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a+ l l+ ++++ +++ ++++l++
AP011115_0 385 DRDRIARDLHDHVIQRLFAVGLSLQSTLQRA--KAP--VVKDRLEQS 427

relarealaevRrllgdLRpaal<-*
+ +++ +++R ++ dL+ +
AP011115_0 428 IDDLHDIVRDIRTAIFDLHGGSG 450

AP011115_2375: domain 1 of 1, from 322 to 389: score 40.8, E = 1.8e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
R+R+ R+LHD+ Q+L ++ l + + ++ + ++e +re+l
AP011115_2 322 ARRRLERDLHDGAQQRLVSLGLEVRMTEASV----PAEwvDVREQLS 364

eirelarealaevRrllgdLRpaal<-*
+++ ++ +++R+l ++++pa+l
AP011115_2 365 AVASGLKGVSEDLRELSHGIHPAIL 389


Histogram of all scores:
score obs exp (one = represents 22 sequences)
----- --- ---
-14 4 0|=
-13 60 1|*==
-12 146 81|===*===
-11 222 664|=========== *
-10 749 1542|=================================== *
-9 1244 1751|========================================================= *
-8 1126 1349|==================================================== *
-7 1049 848|======================================*=========
-6 831 480|=====================*================
-5 769 257|===========*=======================
-4 416 134|======*============
-3 218 69|===*======
-2 158 35|=*======
-1 101 17|*====
0 49 9|*==
1 40 4|*=
2 24 2|*=
3 14 1|*
4 7 0|=
5 4 0|=
6 1 0|=
7 1 0|=
8 1 0|=
9 0 0|
10 1 0|=
11 0 0|
12 0 0|
13 1 0|=
14 0 0|
15 1 0|=
> 16 15 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 4150.0830
P(chi-square) = 0

Total sequences searched: 7252

Whole sequence top hits:
tophits_s report:
Total hits: 12
Satisfying E cutoff: 12
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 12
Satisfying E cutoff: 12
Total memory: 25K


Acknowledgements:

This research is funded by:

Developed by: