hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AP011540.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AP011540_0570 CDS_592240-593502 83.2 1.5e-24 1
AP011540_0761 CDS_816022-814505 66.8 1e-19 2
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AP011540_0570 1/1 223 290 .. 1 70 [] 83.2 1.5e-24
AP011540_0761 1/2 278 320 .. 1 45 [. 44.5 3.8e-13
Alignments of top-scoring domains:
AP011540_0570: domain 1 of 1, from 223 to 290: score 83.2, E = 1.5e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IAR+ HD++g+sL++i+l++ela+rll + dp++a +++++i
AP011540_0 223 EREEIARDVHDVLGHSLTVITLKAELAQRLL--EIDPARAGAEMEAI 267
relarealaevRrllgdLRpaal<-*
++l+r +laevR ++++LR +++
AP011540_0 268 AQLSRASLAEVRSTVTRLRVPDF 290
AP011540_0761: domain 1 of 2, from 278 to 320: score 44.5, E = 3.8e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeeareald<-
ER+RIARE+HD v++sLs+i+ q+++ar+++ +++ + +++++
AP011540_0 278 ERTRIAREMHDIVAHSLSSIISQADGARYAA--ASARTARAQQAE 320
*
AP011540_0 - -
Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 5 0|=
-13 19 0|====
-12 29 22|===*=
-11 60 182|========== *
-10 207 423|=================================== *
-9 354 481|==========================================================*
-8 316 370|===================================================== *
-7 294 233|======================================*==========
-6 190 131|=====================*==========
-5 235 70|===========*============================
-4 127 36|=====*================
-3 64 19|===*=======
-2 39 9|=*=====
-1 15 4|*==
0 14 2|*==
1 10 1|*=
2 6 0|=
3 3 0|=
> 4 5 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1074.2151
P(chi-square) = 0
Total sequences searched: 1992
Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K