hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AY305378.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AY305378_0258 CDS_279984-281972 65.6 4.9e-20 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AY305378_0258 1/1 444 512 .. 1 70 [] 65.6 4.9e-20
Alignments of top-scoring domains:
AY305378_0258: domain 1 of 1, from 444 to 512: score 65.6, E = 4.9e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ A+ LHDs++Q+L ++lq++l++ ++ ++d +eare + ++
AY305378_0 444 ERNLVAQGLHDSIAQGLNFLNLQVQLLADAVG-RDDLPEAREIVPML 489
relarealaevRrllgdLRpaal<-*
r+ ++e++++vR+ll ++R
AY305378_0 490 RHGVEESYQDVRELLNNFRSRLT 512
Histogram of all scores:
score obs exp (one = represents 2 sequences)
----- --- ---
-14 2 0|=
-13 7 0|====
-12 9 4|=*===
-11 25 38|============= *
-10 49 89|========================= *
-9 70 101|=================================== *
-8 58 78|============================= *
-7 49 49|========================*
-6 47 27|=============*==========
-5 51 14|======*===================
-4 20 7|===*======
-3 13 4|=*=====
-2 7 2|*===
-1 4 1|*=
0 0 0|
1 1 0|=
2 4 0|==
3 1 0|=
4 1 0|=
5 0 0|
6 0 0|
> 7 2 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 157.5406
P(chi-square) = 1.056e-30
Total sequences searched: 420
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K