Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for   

Data for BA000012  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: BA000012.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BA000012_2851 CDS_2979263-2980795 157.4 3.1e-53 1
BA000012_6366 CDS_6654348-6655388 147.1 9.9e-50 1
BA000012_1402 CDS_1489082-1487928 143.0 2.6e-48 1
BA000012_2860 CDS_2985502-2986536 133.4 4.8e-45 1
BA000012_2864 CDS_2989356-2987716 126.8 8.2e-43 1
BA000012_5313 CDS_5560843-5562585 87.7 1.7e-29 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BA000012_2851 1/1 319 401 .. 1 85 [] 157.4 3.1e-53
BA000012_6366 1/1 151 233 .. 1 85 [] 147.1 9.9e-50
BA000012_1402 1/1 153 233 .. 1 85 [] 143.0 2.6e-48
BA000012_2860 1/1 151 233 .. 1 85 [] 133.4 4.8e-45
BA000012_2864 1/1 352 434 .. 1 85 [] 126.8 8.2e-43
BA000012_5313 1/1 391 471 .. 1 85 [] 87.7 1.7e-29

Alignments of top-scoring domains:
BA000012_2851: domain 1 of 1, from 319 to 401: score 157.4, E = 3.1e-53
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQ++a+QT+R+a+ + ef+eaFs+RLqAL+ aH+L
BA000012_2 319 ELNHRVKNTLATVQALATQTVRHARQPSEFLEAFSARLQALGIAHNL 365

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+++eW+g +reL+++e++P++++d++Rit+sG d
BA000012_2 366 --LSDREWRGIGIRELVQIEIRPFDTADQPRITISGAD 401

BA000012_6366: domain 1 of 1, from 151 to 233: score 147.1, E = 9.9e-50
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+V +++ T+++++s+d+fv++Fs+R+++L+ +H++
BA000012_6 151 ELHHRVKNTLANVRAMMGATAKSSGSVDDFVRDFSARIVSLADTHSM 197

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt++ W++A+L++Lle+eL++y++ d++R++l+GP+
BA000012_6 198 --LTDDYWQMASLHKLLESELRHYDTSDRPRVVLEGPN 233

BA000012_1402: domain 1 of 1, from 153 to 233: score 143.0, E = 2.6e-48
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+nHRVKN++Av+ S++r T++++ +++ef e +++R++ALsr+HdL
BA000012_1 153 EVNHRVKNQFAVILSMVRETSKRSSDPQEFEELIRARIMALSRSHDL 199

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ seWagA+L++L+++ L P+g +e+i lsGP
BA000012_1 200 --LVTSEWAGASLFDLIQEHLKPFGR--EEQILLSGPV 233

BA000012_2860: domain 1 of 1, from 151 to 233: score 133.4, E = 4.8e-45
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN+LA++QSia+QT R ++ + +f+++F+gRLq+Ls+++dL
BA000012_2 151 EVSHRSKNLLAIIQSIATQTGRYSDGIGDFLTRFRGRLQSLSSSQDL 197

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t s+W+gA L+eL++++++ yg++ ++ ++l G +
BA000012_2 198 --VTSSNWRGAALHELVTSQVGRYGTNTSHSLRLRGAN 233

BA000012_2864: domain 1 of 1, from 352 to 434: score 126.8, E = 8.2e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+ HR+KN+++ V +iarQT+ +a++++ef ++Fs+RLqA+++++d+
BA000012_2 352 EMKHRIKNSITRVLAIARQTASRATDVNEFSASFSARLQAMAASQDM 398

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltrs+W+ AdL++Ll++eL+ g+d + lsGP+
BA000012_2 399 --LTRSRWQKADLADLLRIELGQVFGKDLPEGLLSGPE 434

BA000012_5313: domain 1 of 1, from 391 to 471: score 87.7, E = 1.7e-29
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E HR+ N++ v+++++ + + ++++++ ++e++++R++ L ++H +
BA000012_5 391 EDRHRFSNLFPVIMALVKMINVPENDVAKYKEMLIDRIRTLEATHLI 437

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+r+ +++L++L+++eL+P+ +++t+sGP+
BA000012_5 438 --LSRHTSLSGMLHDLVAQELQPFKE--TRDVTISGPS 471


Histogram of all scores:
score obs exp (one = represents 22 sequences)
----- --- ---
-14 16 0|=
-13 95 0|=====
-12 527 0|========================
-11 690 55|==*=============================
-10 1073 698|===============================*=================
-9 1254 1728|========================================================= *
-8 1170 1794|====================================================== *
-7 803 1205|===================================== *
-6 466 657|====================== *
-5 268 325|============= *
-4 154 154|======*
-3 105 71|===*=
-2 48 33|=*=
-1 37 15|*=
0 18 6|*
1 11 3|*
2 4 1|*
3 3 0|=
> 4 10 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 8123.9761
P(chi-square) = 0

Total sequences searched: 6752

Whole sequence top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: