Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
39 projects found  

7 accessions found for Nostoc sp. PCC 7120  

Data for BA000019  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: BA000019.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BA000019_2236 CDS_2691380-2686257 172.9 4.9e-49 1
BA000019_2092 CDS_2514988-2510024 164.1 2.1e-46 1
BA000019_1279 CDS_1523753-1520928 144.9 6.6e-41 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BA000019_2236 1/1 1514 1600 .. 1 94 [] 172.9 4.9e-49
BA000019_2092 1/1 1459 1545 .. 1 94 [] 164.1 2.1e-46
BA000019_1279 1/1 749 835 .. 1 94 [] 144.9 6.6e-41

Alignments of top-scoring domains:
BA000019_2236: domain 1 of 1, from 1514 to 1600: score 172.9, E = 4.9e-49
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSLLr+Q+r++ de + l ++ EsqnRV+S
BA000019_2 1514 EIHHRVKNNLQIISSLLRMQSRRSFDETT-----LLLFTESQNRVQS 1555

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+s d+ +++fs+Y+++Lt++Lf++ygv+ ++i ++ +
BA000019_2 1556 MALIHEQLYQSADINQINFSDYIKNLTDSLFRCYGVSQKNIMIN--I 1600

BA000019_2092: domain 1 of 1, from 1459 to 1545: score 164.1, E = 2.1e-46
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNL ++SSLL +Q+r+++d+ + ++Lr+sqnR++S
BA000019_2 1459 EIHHRVKNNLGIVSSLLQMQCRRTQDPQA-----NAILRDSQNRIAS 1500

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al HE+LY+s dl ++df++Y+ Lt +Lf+sy+v+s+ i+L+ +
BA000019_2 1501 IALAHEKLYRSNDLANIDFAQYIPDLTTHLFDSYNVKSSCIQLS--I 1545

BA000019_1279: domain 1 of 1, from 749 to 835: score 144.9, E = 6.6e-41
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ++S+LL L+++ kd+e + L+EsqnRV S
BA000019_1 749 EVHHRVKNNLQIVSGLLLLHSQTLKDPEL-----IRTLQESQNRVES 790

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+++iH+ LY+s +++++d+ +Y+++L+ +++ sy+++ ++isL+ +
BA000019_1 791 ISMIHKNLYTSPNIGQLDVVDYINNLATSILISYQLEPGKISLE--T 835


Histogram of all scores:
score obs exp (one = represents 23 sequences)
----- --- ---
-15 11 0|=
-14 37 0|==
-13 79 33|=*==
-12 338 352|===============*
-11 1339 981|==========================================*================
-10 991 1270|============================================ *
-9 927 1073|========================================= *
-8 655 719|============================= *
-7 341 427|=============== *
-6 342 238|==========*====
-5 142 128|=====*=
-4 93 67|==*==
-3 36 35|=*
-2 14 18|*
-1 13 9|*
0 2 5|*
1 1 2|*
2 2 1|*
> 3 5 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 354.9044
P(chi-square) = 0

Total sequences searched: 5368

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: