hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: BA000022.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BA000022_0816 CDS_897354-899888 156.2 2.3e-44 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BA000022_0816 1/1 655 740 .. 1 94 [] 156.2 2.3e-44
Alignments of top-scoring domains:
BA000022_0816: domain 1 of 1, from 655 to 740: score 156.2, E = 2.3e-44
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ++SSLL LQ k+ ++++ + + +E qnR++S
BA000022_0 655 EIHHRVKNNLQIMSSLLYLQFSKA-SPAI-----QQLSEEYQNRIQS 695
mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+sedl ++dfs+Yl++Lt+n++qsyg d i++k l
BA000022_0 696 MALIHEQLYRSEDLANIDFSQYLKNLTHNICQSYGCNTDSIKIK--L 740
Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-15 1 0|=
-14 12 0|=
-13 42 19|=*=
-12 153 208|=========== *
-11 836 579|======================================*=================
-10 645 749|=========================================== *
-9 567 633|====================================== *
-8 358 424|======================== *
-7 215 252|=============== *
-6 204 140|=========*====
-5 54 75|====*
-4 34 40|==*
-3 24 21|=*
-2 11 10|*
-1 3 5|*
0 6 2|*
1 0 1|*
2 0 0|
> 3 2 -|=
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 226.8978
P(chi-square) = 3.565e-312
Total sequences searched: 3167
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K