hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: BA000022.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BA000022_2712 CDS_3032496-3034775 88.7 5.8e-26 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BA000022_2712 1/1 560 627 .. 1 70 [] 88.7 5.8e-26
Alignments of top-scoring domains:
BA000022_2712: domain 1 of 1, from 560 to 627: score 88.7, E = 5.8e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q++++i q+++a+++l ++d e+ +++ld i
BA000022_2 560 ERNRMAREIHDTLAQAFTGILAQVGAAKQVL--TDDVEASQAHLDLI 604
relarealaevRrllgdLRpaal<-*
+elar++l+e+Rr + +LRp+ l
BA000022_2 605 KELARTGLTEARRSVVALRPQLL 627
Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 12 0|==
-13 59 0|======
-12 110 35|===*======
-11 193 290|================== *
-10 542 673|================================================== *
-9 609 764|======================================================== *
-8 485 589|============================================= *
-7 400 370|=================================*===
-6 257 209|==================*=====
-5 236 112|==========*===========
-4 109 58|=====*====
-3 71 30|==*====
-2 33 15|=*=
-1 27 7|*==
0 6 3|*
1 8 2|*
2 7 1|*
3 0 0|
> 4 3 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 579.3287
P(chi-square) = 0
Total sequences searched: 3167
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K