Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

2 accessions found for Streptomyces avermitilis MA-4680  

Data for BA000030  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: BA000030.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BA000030_4684 CDS_5706510-5707715 103.4 6.6e-30 1
BA000030_1468 CDS_1808822-1807485 96.7 6e-28 1
BA000030_6041 CDS_7268025-7269245 94.5 2.8e-27 1
BA000030_4538 CDS_5538158-5539612 91.0 3e-26 1
BA000030_3136 CDS_3906146-3904989 90.8 3.4e-26 1
BA000030_3564 CDS_4410157-4408838 89.6 7.7e-26 1
BA000030_4540 CDS_5540582-5541961 88.5 1.6e-25 1
BA000030_4457 CDS_5437523-5438674 87.6 3e-25 1
BA000030_0935 CDS_1129679-1128492 85.1 1.6e-24 1
BA000030_5627 CDS_6802201-6803397 84.6 2.3e-24 1
BA000030_5873 CDS_7079885-7078512 83.4 5.1e-24 1
BA000030_6479 CDS_7756067-7757212 77.3 3.1e-22 1
BA000030_7395 CDS_8818383-8819549 76.6 5.2e-22 1
BA000030_7076 CDS_8436058-8434880 76.4 5.8e-22 1
BA000030_5750 CDS_6948850-6950259 76.0 7.6e-22 1
BA000030_5608 CDS_6779296-6780648 73.5 4.2e-21 1
BA000030_3635 CDS_4487725-4486436 73.3 4.9e-21 1
BA000030_2063 CDS_2509550-2508252 73.0 5.7e-21 1
BA000030_5996 CDS_7220696-7219416 71.7 1.4e-20 1
BA000030_4148 CDS_5083855-5085111 70.6 2.9e-20 1
BA000030_2879 CDS_3521015-3522199 67.1 3.3e-19 1
BA000030_1994 CDS_2430174-2428735 66.2 6e-19 1
BA000030_2442 CDS_2971976-2970822 65.6 9e-19 1
BA000030_1284 CDS_1590874-1589771 64.6 1.8e-18 1
BA000030_5723 CDS_6916625-6915084 63.4 3.9e-18 1
BA000030_3253 CDS_4046581-4045163 62.2 8.8e-18 2
BA000030_4883 CDS_5933289-5931931 56.8 3.5e-16 1
BA000030_4261 CDS_5220092-5218386 51.2 1.5e-14 1
BA000030_4884 CDS_5934899-5933658 41.9 8.6e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BA000030_4684 1/1 190 257 .. 1 70 [] 103.4 6.6e-30
BA000030_1468 1/1 208 275 .. 1 70 [] 96.7 6e-28
BA000030_6041 1/1 194 261 .. 1 70 [] 94.5 2.8e-27
BA000030_4538 1/1 254 321 .. 1 70 [] 91.0 3e-26
BA000030_3136 1/1 182 250 .. 1 70 [] 90.8 3.4e-26
BA000030_3564 1/1 207 274 .. 1 70 [] 89.6 7.7e-26
BA000030_4540 1/1 251 318 .. 1 70 [] 88.5 1.6e-25
BA000030_4457 1/1 175 242 .. 1 70 [] 87.6 3e-25
BA000030_0935 1/1 194 261 .. 1 70 [] 85.1 1.6e-24
BA000030_5627 1/1 194 261 .. 1 70 [] 84.6 2.3e-24
BA000030_5873 1/1 217 284 .. 1 70 [] 83.4 5.1e-24
BA000030_6479 1/1 183 250 .. 1 70 [] 77.3 3.1e-22
BA000030_7395 1/1 167 231 .. 1 70 [] 76.6 5.2e-22
BA000030_7076 1/1 194 259 .. 1 70 [] 76.4 5.8e-22
BA000030_5750 1/1 279 346 .. 1 70 [] 76.0 7.6e-22
BA000030_5608 1/1 222 295 .. 1 70 [] 73.5 4.2e-21
BA000030_3635 1/1 236 301 .. 1 70 [] 73.3 4.9e-21
BA000030_2063 1/1 207 274 .. 1 70 [] 73.0 5.7e-21
BA000030_5996 1/1 234 301 .. 1 70 [] 71.7 1.4e-20
BA000030_4148 1/1 212 279 .. 1 70 [] 70.6 2.9e-20
BA000030_2879 1/1 190 255 .. 1 70 [] 67.1 3.3e-19
BA000030_1994 1/1 270 337 .. 1 70 [] 66.2 6e-19
BA000030_2442 1/1 195 264 .. 1 70 [] 65.6 9e-19
BA000030_1284 1/1 169 234 .. 1 70 [] 64.6 1.8e-18
BA000030_5723 1/1 309 375 .. 1 70 [] 63.4 3.9e-18
BA000030_3253 2/2 241 310 .. 1 70 [] 61.9 1.1e-17
BA000030_4883 1/1 262 329 .. 1 70 [] 56.8 3.5e-16
BA000030_4261 1/1 366 431 .. 1 70 [] 51.2 1.5e-14
BA000030_4884 1/1 214 283 .. 1 70 [] 41.9 8.6e-12

Alignments of top-scoring domains:
BA000030_4684: domain 1 of 1, from 190 to 257: score 103.4, E = 6.6e-30
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v+++ s++ +q+++a+++l d++p++a++al++i
BA000030_4 190 ERARIARELHDVVAHNVSVMVVQADGAAYVL--DTAPDQAKKALETI 234

relarealaevRrllgdLRpaal<-*
++r+alae+Rrllg+LR++++
BA000030_4 235 SSTGRQALAEMRRLLGVLRTGEH 257

BA000030_1468: domain 1 of 1, from 208 to 275: score 96.7, E = 6e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD++++s+s+i++q+++ ++ll d+dpe+ar+al+ i
BA000030_1 208 ERLRIARELHDVLAHSISVINVQAGVGLALL--DSDPEQARTALTII 252

relarealaevRrllgdLRpaal<-*
+++++eal evR++l +LR++++
BA000030_1 253 KAAGKEALGEVRHVLDTLRTPDE 275

BA000030_6041: domain 1 of 1, from 194 to 261: score 94.5, E = 2.8e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD+v+++++++++q+++a++++ dk p++a+eal+ +
BA000030_6 194 ERLRIARDLHDVVAHHIALVNVQAGVAAHVM--DKRPDQAKEALAHV 238

relarealaevRrllgdLRpaal<-*
re++r al+e+R+++g LR +++
BA000030_6 239 REASRSALNELRATVGLLRQSGD 261

BA000030_4538: domain 1 of 1, from 254 to 321: score 91.0, E = 3e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v++++s+i++q+++a +l+ + + ee+re l+ i
BA000030_4 254 ERSRIARELHDVVAHHMSVISIQAQVAPHLV--ENPSEELRENLAGI 298

relarealaevRrllgdLRpaal<-*
r+ a eal+e+Rr+lg+LR +
BA000030_4 299 RQNALEALTELRRVLGVLRSEDP 321

BA000030_3136: domain 1 of 1, from 182 to 250: score 90.8, E = 3.4e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+AR+LHD +g+sLs+i+l++ela r+l +++pe+a+++++ i
BA000030_3 182 ERLRLARDLHDLLGHSLSLITLKSELAGRML--PDHPEKAAQQVADI 226

relarealaevRrllgdLR.paal<-*
++ +r+al +vR++++++R+p
BA000030_3 227 EQVSRQALVDVREAVTGYRrPRLA 250

BA000030_3564: domain 1 of 1, from 207 to 274: score 89.6, E = 7.7e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+v+++ s++ +++ ++++++ +kdpe+a + ++ +
BA000030_3 207 ERTRIAREMHDVVAHRVSLMVVHAAALQAVA--RKDPEKAVKNAALV 251

relarealaevRrllgdLRpaal<-*
+++r+al+e+R++lg+LR+++
BA000030_3 252 GDMGRQALTELREMLGVLRTGDG 274

BA000030_4540: domain 1 of 1, from 251 to 318: score 88.5, E = 1.6e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHD+v++++s++++q+e+a +++ + +pee+++a+++i
BA000030_4 251 ERTTIARELHDVVAHHMSVVAIQAEAAPYRV--ENPPEELEKAFATI 295

relarealaevRrllgdLRpaal<-*
re a al+e+Rr+lg+ R +
BA000030_4 296 RENAVAALTELRRVLGVVRAEDY 318

BA000030_4457: domain 1 of 1, from 175 to 242: score 87.6, E = 3e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD++++s +++ +q+e+ + +++pe+a++a+d+i
BA000030_4 175 ERARIAREMHDVLSHSVALMVVQAEAGPVSV--RTAPERAEAAFDAI 219

relarealaevRrllgdLRpaal<-*
++++r+a++++Rr+lg+LR+++
BA000030_4 220 AGTGRDAMTQLRRMLGVLREDGS 242

BA000030_0935: domain 1 of 1, from 194 to 261: score 85.1, E = 1.6e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v +s+ +i++++++a ++l + p+ea +al+ i
BA000030_0 194 ERLRIARELHDVVTHSMGLIAVKVGVANHVL--HIRPQEAYDALQVI 238

relarealaevRrllgdLRpaal<-*
++++r+al+++Rr+lg+LR+++
BA000030_0 239 ERTSRTALNDMRRMLGVLRTSEG 261

BA000030_5627: domain 1 of 1, from 194 to 261: score 84.6, E = 2.3e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE+HD v++s+ i+lq+++a+r++ ++ pe+area++++
BA000030_5 194 ERLRIAREMHDMVAHSIGIIALQAGAAARVV--TTQPEAAREAMTAV 238

relarealaevRrllgdLRpaal<-*
+ ++real+ +Rr+lg+LR a++
BA000030_5 239 ENTGREALSGLRRMLGALRQADH 261

BA000030_5873: domain 1 of 1, from 217 to 284: score 83.4, E = 5.1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R +R+LHD +g++Ls+i +++e+arrl+ ++d e+a +++ i
BA000030_5 217 ERLRFSRDLHDLLGHTLSVIVVKSEAARRLA--HRDLEAALLQVTDI 261

relarealaevRrllgdLRpaal<-*
+ +r+al+e+R++++++R++ l
BA000030_5 262 ESVGRQALTEIREAVTGYREGSL 284

BA000030_6479: domain 1 of 1, from 183 to 250: score 77.3, E = 3.1e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+A ELHD v+Q L++++l +++a++l+ d+dp +a+ +l+++
BA000030_6 183 ERSRLAHELHDAVSQKLFSLRLTAQAAAALV--DRDPSRAKGELQQV 227

relarealaevRrllgdLRpaal<-*
++la ea +e+R+++ +LRpaal
BA000030_6 228 AALAAEAADELRAAVVELRPAAL 250

BA000030_7395: domain 1 of 1, from 167 to 231: score 76.6, E = 5.2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R ++ELHD+vgQ+L+a+ lql +++ d++pe +r++++++
BA000030_7 167 ERHRVSQELHDEVGQTLTAVLLQLRRVA-----DRAPEGLRAEVRQA 208

relarealaevRrllgdLRpaal<-*
+e+ r +l+e+Rr++++LRp++l
BA000030_7 209 QEATRGSLDEIRRIARRLRPGVL 231

BA000030_7076: domain 1 of 1, from 194 to 259: score 76.4, E = 5.8e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHDs+g++L+++ +q+++ar+ + dp ++ald+i
BA000030_7 194 ERTRIARELHDSIGHALTVAVVQAGAARA----AGDPRFTDRALDAI 236

relarealaevRrllgdLRpaal<-*
+e++r al+++ r+lg+LR+a+
BA000030_7 237 EETGRAALEDLERVLGVLREAER 259

BA000030_5750: domain 1 of 1, from 279 to 346: score 76.0, E = 7.6e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L ++++ l+lar+ l ++ p+ear+ +de+
BA000030_5 279 ERRRIERDLHDGAQQRLVSLAMNLGLARATL--TDLPPEARRVIDEA 323

relarealaevRrllgdLRpaal<-*
++ a+ea++e+ +l+++L+pa+l
BA000030_5 324 HREAKEAIEELNNLVRGLHPAVL 346

BA000030_5608: domain 1 of 1, from 222 to 295: score 73.5, E = 4.2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.....eare
ER RIAR+LHD +++s+++i +q+++a+++l ++dpe+ ++ ++++
BA000030_5 222 ERLRIARDLHDLLAHSITLIGVQTSVAAHVL--AADPErldraAVAK 266

aldeirelarealaevRrllgdLR.paal<-*
ald i+e++r a e+R +l +LR+++a+
BA000030_5 267 ALDDIAETCRSARGELRTTLEVLReHTAD 295

BA000030_3635: domain 1 of 1, from 236 to 301: score 73.3, E = 4.9e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L a+++ l+lar d++p++++++l+ +
BA000030_3 236 ERRRIERDLHDGAQQRLVALTMTLGLARL----DAPPGPLADQLAKA 278

relarealaevRrllgdLRpaal<-*
+e a +al+e+R+l+++++p +l
BA000030_3 279 HEEAGKALEELRELIHGIHPKVL 301

BA000030_2063: domain 1 of 1, from 207 to 274: score 73.0, E = 5.7e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR RELHD+vg+++s+i++ +e+ar ++ + p+ +++l i
BA000030_2 207 ERARTVRELHDVVGHHISMIAVRAETARVAT--PGMPAVGADRLLGI 251

relarealaevRrllgdLRpaal<-*
++ar al+e+Rrllg+LR++++
BA000030_2 252 GDTARAALTEMRRLLGVLREDTE 274

BA000030_5996: domain 1 of 1, from 234 to 301: score 71.7, E = 1.4e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+ + l+++++l+ +kdp++are l+++
BA000030_5 234 ELRRIERDLHDGAQARLVAMGMDLGTIEALI--EKDPAKARELLARA 278

relarealaevRrllgdLRpaal<-*
r+ + +al+e+R+l+++++p++l
BA000030_5 279 RKSSADALTELRDLVRGIHPPVL 301

BA000030_4148: domain 1 of 1, from 212 to 279: score 70.6, E = 2.9e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R R+LHD+ g +L++i+l++ela +l+ +++ +ea e++ e+
BA000030_4 212 ERLRFGRDLHDVMGRNLAVIALKSELAVQLA--RRERPEAVEQMIEV 256

relarealaevRrllgdLRpaal<-*
+++are+++evR++++++R+a+l
BA000030_4 257 QRIARESQREVREVVRGYREADL 279

BA000030_2879: domain 1 of 1, from 190 to 255: score 67.1, E = 3.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD v+ +Lsai++++ +a+ + ++p+ real i
BA000030_2 190 ERARMARELHDMVANHLSAIAIHSTAAL-SI---DEPGTSREALGVI 232

relarealaevRrllgdLRpaal<-*
re + +lae+Rrl+g LR+++
BA000030_2 233 RENSVAGLAEMRRLIGILRDGDG 255

BA000030_1994: domain 1 of 1, from 270 to 337: score 66.2, E = 6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IARE+HD+++++L+++++++++++ + d++ ee+++a+ i
BA000030_1 270 AREAIAREMHDVLAHRLTLLSVHAGALEFRP--DAPREEIARAAGVI 314

relarealaevRrllgdLRpaal<-*
re a+eal+++R+++g+LR ++
BA000030_1 315 RESAHEALQDLREIIGVLRAGDA 337

BA000030_2442: domain 1 of 1, from 195 to 264: score 65.6, E = 9e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ERaRIARE+HD++++sLsa ++le+ar l+ ++ ++++++ ++
BA000030_2 195 ERARIAREIHDVLAHSLSAQLVHLEAARLLI--ERGADreQILGRVV 239

eirelarealaevRrllgdLRpaal<-*
++r++are+lae+R++l++LR +
BA000030_2 240 AARGMAREGLAETRQALSALRGEIS 264

BA000030_1284: domain 1 of 1, from 169 to 234: score 64.6, E = 1.8e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa +ARE+HD+v+++ s+i++ +++++ + +++ ++ea+++i
BA000030_1 169 ERAQLAREMHDVVSHQVSLIAVRAGALQVGT--QDA--DVKEAAATI 211

relarealaevRrllgdLRpaal<-*
r+l+ ++l+e+R+++++LR ++
BA000030_1 212 RRLSVQTLDELRHMVSVLRASGG 234

BA000030_5723: domain 1 of 1, from 309 to 375: score 63.4, E = 3.9e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a ++le +r++ +++ + e+l ++
BA000030_5 309 DRDRIARDLHDLVVQRLFATGMMLESTQRRA--AEE--DVHETLGRA 351

relarealaevRrllgdLR.paal<-*
+++r + +evR ++ +L++p+a+
BA000030_5 352 VDALRSTVQEVRTAIFALQqPPAD 375

BA000030_3253: domain 2 of 2, from 241 to 310: score 61.9, E = 1.1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARE+HDsv+ +L +++l ++++++ +d ++dp++++++++ +
BA000030_3 241 ERARLAREMHDSVAKTLHGLALAADALAASTD-HSDPAALKRQATVV 286

relarealaevRrllgdLR.paal<-*
+++ar+a ae R+ll+dLR+++++
BA000030_3 287 AGAARRAAAESRDLLSDLRrHTDF 310

BA000030_4883: domain 1 of 1, from 262 to 329: score 56.8, E = 3.5e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+RI R+LHD+ +L a+++ l+la+ l ++dp ea++ +de+
BA000030_4 262 DLRRIERDLHDGAQARLVALAMDLGLAKEKL--AEDPREAARMVDEA 306

relarealaevRrllgdLRpaal<-*
++ +++al+e+R+l+++++pa+l
BA000030_4 307 HGEVKTALQELRDLARGIHPAVL 329

BA000030_4261: domain 1 of 1, from 366 to 431: score 51.2, E = 1.5e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L a ++le a+r ++ +e+r+ + +
BA000030_4 366 DRDRIARDLHDLVIQRLYATGMMLESAQR----RSGVPEVRRGVGKA 408

relarealaevRrllgdLRpaal<-*
+ ++ +++e+R ++ +L+ +
BA000030_4 409 VDELDVTIQEIRTAIFALQQGPA 431

BA000030_4884: domain 1 of 1, from 214 to 283: score 41.9, E = 8.6e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+RI R+LHD+ +L ++++l+la+ l ++e +++ +de+
BA000030_4 214 DLRRIERDLHDGAQARLVNLAMGLGLAKEKLLEGQADESVAAMVDEA 260

relarealaevRrllgdLRpaal<-*
++ ++ al+e+R+l+++++pa+l
BA000030_4 261 HGEVKLALQELRDLARGIHPAVL 283


Histogram of all scores:
score obs exp (one = represents 20 sequences)
----- --- ---
-14 9 0|=
-13 48 1|*==
-12 124 84|====*==
-11 210 694|=========== *
-10 680 1611|================================== *
-9 1152 1829|==========================================================*
-8 1093 1410|======================================================= *
-7 1074 886|============================================*=========
-6 875 501|=========================*==================
-5 880 269|=============*==============================
-4 535 140|======*====================
-3 305 72|===*============
-2 207 36|=*=========
-1 144 18|*=======
0 72 9|*===
1 51 4|*==
2 40 2|*=
3 15 1|*
4 8 0|=
5 8 0|=
6 3 0|=
7 2 0|=
8 1 0|=
9 2 0|=
10 2 0|=
11 2 0|=
12 2 0|=
> 13 33 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 6803.6255
P(chi-square) = 0

Total sequences searched: 7577

Whole sequence top hits:
tophits_s report:
Total hits: 29
Satisfying E cutoff: 29
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 29
Satisfying E cutoff: 29
Total memory: 31K


Acknowledgements:

This research is funded by:

Developed by: