Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

3 accessions found for Corynebacterium efficiens YS-314  

Data for BA000035  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: BA000035.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BA000035_1019 CDS_1078812-1080071 82.6 3.5e-24 1
BA000035_1353 CDS_1420910-1422097 74.6 7.8e-22 1
BA000035_2779 CDS_2969540-2968251 57.8 6.7e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BA000035_1019 1/1 236 303 .. 1 70 [] 82.6 3.5e-24
BA000035_1353 1/1 201 270 .. 1 70 [] 74.6 7.8e-22
BA000035_2779 1/1 218 292 .. 1 70 [] 57.8 6.7e-17

Alignments of top-scoring domains:
BA000035_1019: domain 1 of 1, from 236 to 303: score 82.6, E = 3.5e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R A+ELHD++gQ+L+a++l++e+a++l+ ++ +++++++l+e+
BA000035_1 236 ERLRFAQELHDTLGQHLAAMSLKSEVALALA--TRGDDRLEDELREL 280

relarealaevRrllgdLRpaal<-*
++lar++++++R++++++R l
BA000035_1 281 QTLARTSMSQMREVVQGYRSINL 303

BA000035_1353: domain 1 of 1, from 201 to 270: score 74.6, E = 7.8e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++++sL++++ ++++a++ + pe a++a+ ++
BA000035_1 201 ERERIAREMHDVIAHSLAVMIAMADGAHATA--VHRPEVAKQAMGRV 245

relarealaevRrllgdLR..paal<-*
++ +r++l+evRrllg +++p+ +
BA000035_1 246 ADVGRRTLDEVRRLLGSVQgePPPD 270

BA000035_2779: domain 1 of 1, from 218 to 292: score 57.8, E = 6.7e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.....dkdpeeare
ER+RIA E+HD+v+Q+Ls+i + l++a++ + ++ ++d++++
BA000035_2 218 ERQRIAHEIHDTVAQGLSSIQMLLHVAEQEILArglgeDDAAGSPLH 264

aldeirelarealaevRrllgdLRpaal<-*
++ +r++a++ l+e+R+++ +L+paal
BA000035_2 265 KIRLARTTASDNLSEARAMIAALQPAAL 292


Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-14 3 0|=
-13 58 0|=======
-12 78 32|===*=====
-11 127 269|=============== *
-10 361 625|========================================= *
-9 524 710|==========================================================*
-8 448 547|================================================== *
-7 419 344|======================================*========
-6 300 194|=====================*============
-5 283 104|===========*====================
-4 144 54|=====*==========
-3 74 28|===*=====
-2 38 14|=*===
-1 35 7|*===
0 22 3|*==
1 12 1|*=
2 3 0|=
3 2 0|=
4 2 0|=
5 1 0|=
6 2 0|=
7 0 0|
8 0 0|
9 1 0|=
10 0 0|
11 0 0|
> 12 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1060.4987
P(chi-square) = 0

Total sequences searched: 2942

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: