Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Corynebacterium glutamicum ATCC 13032  

Data for BA000036  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: BA000036.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BA000036_0948 CDS_1004829-1006088 85.8 4.1e-25 1
BA000036_2010 CDS_2124996-2123845 76.1 2.9e-22 1
BA000036_2936 CDS_3137904-3136591 60.2 1.4e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BA000036_0948 1/1 230 297 .. 1 70 [] 85.8 4.1e-25
BA000036_2010 1/1 183 248 .. 1 70 [] 76.1 2.9e-22
BA000036_2936 1/1 201 274 .. 1 70 [] 60.2 1.4e-17

Alignments of top-scoring domains:
BA000036_0948: domain 1 of 1, from 230 to 297: score 85.8, E = 4.1e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R A+ELHD++gQ+L+a+++++ela++l+ ++ +++++ +l+e+
BA000036_0 230 ERLRFAQELHDTLGQHLAAMSVKSELALALA--KRGDDRLENELREL 274

relarealaevRrllgdLRpaal<-*
++l r++++e+R++++++R+ l
BA000036_0 275 QKLTRTSMSEMRDVVSGYRTVNL 297

BA000036_2010: domain 1 of 1, from 183 to 248: score 76.1, E = 2.9e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIA E+HD+v+Q+Ls+i + l++a++++ d++ +a +++ +
BA000036_2 183 ERARIAGEIHDTVAQGLSSIQMLLHAAEKRV--DDP--QALSHIRLA 225

relarealaevRrllgdLRpaal<-*
r++ + lae+R+++ +L+p+ l
BA000036_2 226 RQTTADNLAETRQIIAALQPTPL 248

BA000036_2936: domain 1 of 1, from 201 to 274: score 60.2, E = 1.4e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrllds....dkdpeearea
ER+RIA E+HD+v+Q+Ls+i + l++ ++ + + ++k+ e++ +
BA000036_2 201 ERQRIAHEIHDTVAQGLSSIQMLLHVSEQEILVaemeEKPKEAIVKK 247

ldeirelarealaevRrllgdLRpaal<-*
++ +r++a++ l+e+R+++ +L+paal
BA000036_2 248 MRLARQTASDNLSEARAMIAALQPAAL 274


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 11 0|==
-13 65 0|=======
-12 128 34|===*=========
-11 163 284|================= *
-10 522 659|===================================================== *
-9 565 748|========================================================= *
-8 451 576|============================================== *
-7 375 362|====================================*=
-6 277 205|====================*=======
-5 249 110|==========*==============
-4 124 57|=====*=======
-3 64 29|==*====
-2 45 15|=*===
-1 18 7|*=
0 20 3|*=
1 6 1|*
2 3 1|*
3 3 0|=
4 2 0|=
5 0 0|
6 1 0|=
> 7 7 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 795.4743
P(chi-square) = 0

Total sequences searched: 3099

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: