Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Bradyrhizobium japonicum USDA 110  

Data for BA000040  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: BA000040.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BA000040_2795 CDS_3073528-3072071 137.8 1.8e-46 1
BA000040_1461 CDS_1591910-1593568 127.1 7.9e-43 1
BA000040_7183 CDS_7906453-7905659 123.9 1e-41 1
BA000040_2598 CDS_2841583-2840093 121.2 8.3e-41 1
BA000040_8039 CDS_8820887-8822089 115.7 6.4e-39 1
BA000040_7708 CDS_8455284-8454247 115.3 8.3e-39 1
BA000040_0892 CDS_971467-970496 98.8 3.5e-33 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BA000040_2795 1/1 297 377 .. 1 85 [] 137.8 1.8e-46
BA000040_1461 1/1 347 425 .. 1 85 [] 127.1 7.9e-43
BA000040_7183 1/1 72 154 .. 1 85 [] 123.9 1e-41
BA000040_2598 1/1 292 370 .. 1 85 [] 121.2 8.3e-41
BA000040_8039 1/1 213 296 .. 1 85 [] 115.7 6.4e-39
BA000040_7708 1/1 164 245 .. 1 85 [] 115.3 8.3e-39
BA000040_0892 1/1 142 218 .. 1 85 [] 98.8 3.5e-33

Alignments of top-scoring domains:
BA000040_2795: domain 1 of 1, from 297 to 377: score 137.8, E = 1.8e-46
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+ Q+ia QT+R + e +++F+gRL AL++aH+L
BA000040_2 297 ELNHRVKNTLALMQAIAVQTFR--SASREERAKFEGRLGALAEAHNL 341

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+++ Wag +L+e+++++L+P+ +++eRi+++GP+
BA000040_2 342 --LSQEKWAGSELKEVITRALQPFLLNAPERIRMDGPA 377

BA000040_1461: domain 1 of 1, from 347 to 425: score 127.1, E = 7.9e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LAv+QSi++ TlR+ a++d ++e ++gR++A+s++ +L
BA000040_1 347 ELNHRVKNILAVIQSIVTRTLRHGADIDGARELLIGRIHAMSNVVSL 393

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++s+W+g+ L+ L ea P+ a+Ri ++GPd
BA000040_1 394 --LSESQWQGVKLKGLFEARAIPH----ADRIAVTGPD 425

BA000040_7183: domain 1 of 1, from 72 to 154: score 123.9, E = 1e-41
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KNtLA+V++i+ Q+lR+++ l+++ +a++gRL AL+raHdL
BA000040_7 72 ELHHRIKNTLATVSAIVSQSLRGEQGLAHAQQAIAGRLLALGRAHDL 118

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+r++ ++AdL++++++++++++++++ + +sGPd
BA000040_7 119 --LVRASLSSADLGAVVRSAVEAFDDPAESKFSISGPD 154

BA000040_2598: domain 1 of 1, from 292 to 370: score 121.2, E = 8.3e-41
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR KN LA+ QSi+r T +a++++++v a++gR+ AL+r+H +
BA000040_2 292 EVDHRAKNALALAQSIVRLT--RADEVKAYVNAVEGRINALARVHTI 336

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ s+W+gA+L++L+ +eLaPy +++i l GP+
BA000040_2 337 --LSLSSWQGAELSKLIDEELAPYSL--GGQIKLAGPE 370

BA000040_8039: domain 1 of 1, from 213 to 296: score 115.7, E = 6.4e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN+++v S++r+T+Rnaa+++e++e++sgRL+AL++a +L
BA000040_8 213 EMSHRIKNLFSVADSMVRMTARNAATKEELAETLSGRLHALAQANGL 259

V.p.LtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+++++ + +a A+L++L+e+ L+P++ ++ +l+GPd
BA000040_8 260 IrRsFGSDVAAVASLSDLVERILRPHE---RQPSVLEGPD 296

BA000040_7708: domain 1 of 1, from 164 to 245: score 115.3, E = 8.3e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E HR+KN+LA+VQ+i++ + ++++++ ++e +sgR+qA++++H+L
BA000040_7 164 EAEHRSKNILANVQAIINLS--QSDTSERLKEVISGRIQAMANVHSL 208

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
+++++W gA+ ++++ +eLaPy +e+++ Ri+++G +
BA000040_7 209 --FVETRWIGAEVSAIAKQELAPYLQEgQDKRIVMEGLQ 245

BA000040_0892: domain 1 of 1, from 142 to 218: score 98.8, E = 3.5e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KN L++V+++++Q l+ + ++ +++++ RL++L+++ dL
BA000040_0 142 ELQHRLKNKLSTVHAVIHQVLH---DQPQVWARVDPRLRSLAATDDL 185

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
++r + ag+d+r+Ll +eL+Pyg + R+tl G++
BA000040_0 186 --ISRIDKAGCDIRDLLISELGPYG---HVRFTLNGDR 218


Histogram of all scores:
score obs exp (one = represents 26 sequences)
----- --- ---
-14 12 0|=
-13 89 0|====
-12 606 0|========================
-11 840 67|==*==============================
-10 1302 860|=================================*=================
-9 1512 2128|==========================================================*
-8 1485 2209|==========================================================*
-7 1011 1484|======================================= *
-6 563 810|====================== *
-5 392 401|===============*
-4 217 190|=======*=
-3 122 88|===*=
-2 79 40|=*==
-1 37 18|*=
0 14 8|*
1 15 3|*
2 4 1|*
3 1 0|=
4 5 0|=
> 5 11 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 9713.9424
P(chi-square) = 0

Total sequences searched: 8317

Whole sequence top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: