Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
39 projects found  

1 accessions found for Gloeobacter violaceus PCC 7421  

Data for BA000045  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: BA000045.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BA000045_1767 CDS_1873534-1875546 152.0 5.2e-43 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BA000045_1767 1/1 477 563 .. 1 94 [] 152.0 5.2e-43

Alignments of top-scoring domains:
BA000045_1767: domain 1 of 1, from 477 to 563: score 152.0, E = 5.2e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQv++SLLrLQa+++ d + +eaL+ +++RV+S
BA000045_1 477 EIHHRVKNNLQVVTSLLRLQAHQTVDAAS-----IEALQTCRRRVQS 518

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA iHE LY+s+dl +vdf+eY++ + ++L++sy+ + ++++Lk +
BA000045_1 519 MASIHELLYQSGDLASVDFGEYVRLIGHQLIRSYRARPGKVRLK--M 563


Histogram of all scores:
score obs exp (one = represents 21 sequences)
----- --- ---
-15 8 0|=
-14 35 0|==
-13 84 27|=*==
-12 350 290|=============*===
-11 1233 810|======================================*====================
-10 936 1048|============================================= *
-9 647 885|=============================== *
-8 496 594|======================== *
-7 249 352|============ *
-6 205 196|=========*
-5 90 105|====*
-4 41 56|==*
-3 27 29|=*
-2 12 15|*
-1 3 7|*
0 5 4|*
1 4 2|*
2 2 1|*
3 1 0|=
> 4 2 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 477.5130
P(chi-square) = 0

Total sequences searched: 4430

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: