Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
39 projects found  

1 accessions found for Gloeobacter violaceus PCC 7421  

Data for BA000045  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: BA000045.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BA000045_0347 CDS_362228-363436 94.9 1.2e-27 1
BA000045_3986 CDS_4187531-4189498 81.9 8.3e-24 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BA000045_0347 1/1 212 280 .. 1 70 [] 94.9 1.2e-27
BA000045_3986 1/1 459 526 .. 1 70 [] 81.9 8.3e-24

Alignments of top-scoring domains:
BA000045_0347: domain 1 of 1, from 212 to 280: score 94.9, E = 1.2e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR++HDs+g++L+a+ ++le+a+ l+ +dp++ar+a++++
BA000045_0 212 ERARIARDIHDSLGHTLTALDVKLEVAQELY--CRDPDRARQAVHTA 256

relarealaevRrllgdLR.paal<-*
++l+ ++l++vR +++++R+p+ +
BA000045_0 257 KQLSGQCLQDVRLAVQAMRrPPLH 280

BA000045_3986: domain 1 of 1, from 459 to 526: score 81.9, E = 8.3e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD++ Q+L++i +ql++a + +dp r+++d++
BA000045_3 459 ERNRMARELHDTLMQGLAGIVVQLQAATDAG--VADPLDGRDHIDRA 503

relarealaevRrllgdLRpaal<-*
r+lar++lae+Rr +++LRp+ l
BA000045_3 504 RTLARRSLAEARRSVRALRPQLL 526


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 10 0|=
-13 37 0|===
-12 90 49|===*===
-11 159 406|============= *
-10 534 942|========================================== *
-9 732 1069|========================================================= *
-8 600 824|=============================================== *
-7 609 518|=======================================*=======
-6 512 293|======================*=================
-5 469 157|============*========================
-4 249 82|======*=============
-3 164 42|===*=========
-2 107 21|=*=======
-1 72 10|*=====
0 32 5|*==
1 24 2|*=
2 12 1|*
3 5 0|=
4 5 0|=
5 3 0|=
6 1 0|=
7 1 0|=
8 0 0|
> 9 3 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2815.3362
P(chi-square) = 0

Total sequences searched: 4430

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: