Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Corynebacterium diphtheriae NCTC 13129  

Data for BX248353  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: BX248353.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BX248353_0443 CDS_428385-429611 87.8 8.1e-26 1
BX248353_2265 CDS_2430452-2431705 71.1 6.4e-21 1
BX248353_0084 CDS_77708-76479 67.5 7.6e-20 1
BX248353_2209 CDS_2361153-2359774 52.4 2.1e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BX248353_0443 1/1 206 273 .. 1 70 [] 87.8 8.1e-26
BX248353_2265 1/1 206 274 .. 1 70 [] 71.1 6.4e-21
BX248353_0084 1/1 212 275 .. 1 70 [] 67.5 7.6e-20
BX248353_2209 1/1 242 315 .. 1 70 [] 52.4 2.1e-15

Alignments of top-scoring domains:
BX248353_0443: domain 1 of 1, from 206 to 273: score 87.8, E = 8.1e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD v++sL++++ q+++ r + +++p++a +al++i
BX248353_0 206 ERNRIAREMHDIVAHSLTVVIAQADGGRFAG--RDNPQQALAALETI 250

relarealaevRrllgdLRpaal<-*
+real+++R ll++LR++++
BX248353_0 251 SSVGREALSQMRGLLSVLRETDD 273

BX248353_2265: domain 1 of 1, from 206 to 274: score 71.1, E = 6.4e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++RE+HD+v+Q+Ls+i + + +a+ +ld + + e ++++l i
BX248353_2 206 ERERLSREIHDTVAQGLSSIVILARAAHGRLD-KGEIEDVAQQLSVI 251

relarealaevRrllgdLRpaal<-*
++ a+++lae+Rr ++dL +al
BX248353_2 252 ETQASDSLAEARRFVRDLAAPAL 274

BX248353_0084: domain 1 of 1, from 212 to 275: score 67.5, E = 7.6e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E IARELHD++++sL++ik+q+++ ++ real+ei
BX248353_0 212 EKLLIARELHDVLAHSLTLIKVQAQAGLYGG-------DQREALEEI 251

relarealaevRrllgdLR.paal<-*
+a ++l+evR ++++LR+p++
BX248353_0 252 LNAAATSLEEVRGIVQALRdPTQS 275

BX248353_2209: domain 1 of 1, from 242 to 315: score 52.4, E = 2.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpe....eare
ER+RIA E+HD+++Q+Ls+i + l +a++ + ++ pe ++++
BX248353_2 242 ERQRIAHEIHDTLAQGLSSIQMLLRVAEQDI-KkSGMPEaeqqAPLH 287

aldeirelarealaevRrllgdLRpaal<-*
+++ +r +a e l+e+R+++ +L+paal
BX248353_2 288 RMELARSTAAENLREARAMIAALQPAAL 315


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-14 14 0|==
-13 41 0|======
-12 88 25|===*=========
-11 129 208|=================== *
-10 324 483|=============================================== *
-9 381 548|======================================================= *
-8 359 422|==================================================== *
-7 312 265|=====================================*=======
-6 213 150|=====================*=========
-5 177 80|===========*==============
-4 90 42|=====*=======
-3 59 21|==*======
-2 32 11|=*===
-1 20 5|*==
0 12 2|*=
1 7 1|*
2 3 0|=
3 2 0|=
4 2 0|=
5 0 0|
> 6 7 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 641.8002
P(chi-square) = 0

Total sequences searched: 2320

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: