Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Photorhabdus luminescens subsp. laumondii TTO1  

Data for BX470251  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: BX470251.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BX470251_2039 CDS_2411939-2410707 58.3 8.3e-17 1
BX470251_0814 CDS_946350-944806 54.8 8.9e-16 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BX470251_2039 1/1 214 282 .. 1 70 [] 58.3 8.3e-17
BX470251_0814 1/1 319 380 .. 5 70 .] 54.8 8.9e-16

Alignments of top-scoring domains:
BX470251_2039: domain 1 of 1, from 214 to 282: score 58.3, E = 8.3e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ I+RELHDs++QsLs +k+q+ + d p + + l +i
BX470251_2 214 ERTAISRELHDSIAQSLSFLKIQVNCLYIGS--DNLPKQSLTSLNMI 258

relarealaevRrllgdLR.paal<-*
++ ++ a++++R+ll ++R+++
BX470251_2 259 KDELNIAYRQLRELLATFRnEQPQ 282

BX470251_0814: domain 1 of 1, from 319 to 380: score 54.8, E = 8.9e-16
*->IARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeirela
IARELHD++gQ+++ai +q+ l++r + +++ + + +++i la
BX470251_0 319 IARELHDEIGQNITAIQIQATLIKRTA--TTP--ATEMIAEQINNLA 361

realaevRrllgdLRpaal<-*
++ + +R+ll++LRp++l
BX470251_0 362 QQIHQSTRQLLRQLRPPVL 380


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-14 23 0|==
-13 165 0|==========
-12 245 52|===*===========
-11 346 429|===================== *
-10 869 995|==================================================== *
-9 976 1130|==========================================================*
-8 638 871|====================================== *
-7 534 547|================================*
-6 348 310|==================*==
-5 213 166|=========*===
-4 126 86|=====*==
-3 88 44|==*===
-2 43 22|=*=
-1 32 11|*=
0 18 5|*=
1 14 2|*
2 0 1|*
3 2 0|=
> 4 3 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 982.1047
P(chi-square) = 0

Total sequences searched: 4905

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: