hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: BX571656.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BX571656_1787 CDS_1853281-1855275 109.1 3.7e-31 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BX571656_1787 1/1 471 557 .. 1 94 [] 109.1 3.7e-31
Alignments of top-scoring domains:
BX571656_1787: domain 1 of 1, from 471 to 557: score 109.1, E = 3.7e-31
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNL+vI++L+ L + k+++ee + +L E + R+ +
BX571656_1 471 EVHHRVKNNLAVIIALIALKTPKATSEES-----KTLLVELEERIYT 512
mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+ l+H++LY+s++l++++++eY++++++ + ++++ ++ gi++ l
BX571656_1 513 IELLHRKLYQSKNLKRIEMKEYIQEIVHRIGELHETERLGIRIA--L 557
Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-15 1 0|=
-14 3 0|=
-13 18 12|=*=
-12 76 134|========== *
-11 414 373|==============================================*=====
-10 378 483|================================================ *
-9 380 408|================================================ *
-8 300 274|==================================*===
-7 165 162|====================*
-6 176 90|===========*==========
-5 59 48|=====*==
-4 42 25|===*==
-3 13 13|=*
-2 9 7|*=
-1 6 3|*
0 1 1|*
1 0 0|
> 2 3 -|=
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 152.3107
P(chi-square) = 5.024e-27
Total sequences searched: 2044
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K