Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Rhodopseudomonas palustris CGA009  

Data for BX571963  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: BX571963.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BX571963_4224 CDS_4769913-4768147 129.4 7.8e-44 1
BX571963_2786 CDS_3160874-3161932 122.9 1.2e-41 1
BX571963_0990 CDS_1095403-1092866 118.5 4e-40 1
BX571963_0007 CDS_10893-9442 115.6 3.8e-39 1
BX571963_3314 CDS_3740366-3743506 108.8 8.2e-37 1
BX571963_2073 CDS_2335697-2333796 108.3 1.2e-36 1
BX571963_4007 CDS_4532346-4534394 94.5 5.8e-32 1
BX571963_0755 CDS_836258-834822 87.3 1.7e-29 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BX571963_4224 1/1 376 454 .. 1 85 [] 129.4 7.8e-44
BX571963_2786 1/1 159 243 .. 1 85 [] 122.9 1.2e-41
BX571963_0990 1/1 520 598 .. 1 85 [] 118.5 4e-40
BX571963_0007 1/1 302 384 .. 1 85 [] 115.6 3.8e-39
BX571963_3314 1/1 853 935 .. 1 85 [] 108.8 8.2e-37
BX571963_2073 1/1 434 516 .. 1 85 [] 108.3 1.2e-36
BX571963_4007 1/1 493 572 .. 1 85 [] 94.5 5.8e-32
BX571963_0755 1/1 289 366 .. 1 85 [] 87.3 1.7e-29

Alignments of top-scoring domains:
BX571963_4224: domain 1 of 1, from 376 to 454: score 129.4, E = 7.8e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LAv+QSi++ TlR+ +ld ++e ++gR++A+s++ +L
BX571963_4 376 ELNHRVKNILAVIQSIVTRTLRHGSDLDVARELLIGRIHAMSNVVSL 422

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++s+W+g++L+ L e P+ a+Ri+++GPd
BX571963_4 423 --LSDSQWQGVMLKGLFEGRAIPH----ADRIEVDGPD 454

BX571963_2786: domain 1 of 1, from 159 to 243: score 122.9, E = 1.2e-41
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN LA+VQ+i+ Q lR++ +++ +a++ RL+ALsr+HdL
BX571963_2 159 ELNHRVKNVLATVQAIVWQALRTSSDPKTIQQAIESRLVALSRSHDL 205

VpLtrseWagAdLreLleaeLaPygged..aeRitlsGPd<-*
Ltr++W++A L+++++ +L+P++ +d+ ++Ri + G++
BX571963_2 206 --LTRENWESAGLHDIIANALEPFERADglSGRIFIAGDN 243

BX571963_0990: domain 1 of 1, from 520 to 598: score 118.5, E = 4e-40
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LA++ S+++Q + sl+ef+ a++gR++ALs aHd+
BX571963_0 520 ELNHRVKNILALIKSLVNQPAGEGKSLEEFASALRGRIMALSFAHDQ 566

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
++rs+ +g+ L +L++aeL+Py a +itl+GPd
BX571963_0 567 --VVRSD-GGGALLDLIQAELSPYP---ASQITLEGPD 598

BX571963_0007: domain 1 of 1, from 302 to 384: score 115.6, E = 3.8e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtL++V++i + T+ +++++++f +F+gR+qAL+++H L
BX571963_0 302 ELDHRVKNTLTMVMAICARTAAHERTIEDFQKSFTGRIQALAATHTL 348

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ ++W+ ++r++l+aeLaP+++ ++Ri+ +G d
BX571963_0 349 --LSNASWQNLHIRDVLAAELAPFASLSSGRIVTDGLD 384

BX571963_3314: domain 1 of 1, from 853 to 935: score 108.8, E = 8.2e-37
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR N +Av+ +iarQT+Rn+asl+ f ++F RL AL++a L
BX571963_3 853 ELQHRTNNVFAVILAIARQTVRNSASLETFEQQFGTRLLALAQANAL 899

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++ eW g++L +L+ea+LaP+ g d++R++l GP+
BX571963_3 900 --LVDQEWKGVSLEKLIEAQLAPFIGGDSTRLELVGPP 935

BX571963_2073: domain 1 of 1, from 434 to 516: score 108.3, E = 1.2e-36
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N++AvVQSia QT + ++++ef+ +F +RL AL+r+++L
BX571963_2 434 ELQHRTRNLIAVVQSIAEQTMASCGTMEEFRPQFNDRLTALARVQGL 480

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+rs ++ +++ L++a+L++ g+ d+ R+t+sGP+
BX571963_2 481 --LSRSAQEPITIATLVRAALDALGTVDRNRVTISGPN 516

BX571963_4007: domain 1 of 1, from 493 to 572: score 94.5, E = 5.8e-32
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KNtLA+V++iarQTlR+ ++ + veaF +RLqALs aH
BX571963_4 493 ELSHRMKNTLAMVMAIARQTLRSIPDQAP-VEAFNARLQALSTAHMA 538

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + +W A + e++ +++ +g +R+t+sGP+
BX571963_4 539 --LLQQHWTAAKINEVVKGVVGAVEG--LDRFTISGPA 572

BX571963_0755: domain 1 of 1, from 289 to 366: score 87.3, E = 1.7e-29
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E nHR KN LAvVQ+++ T +f+e++ +RLqALsr +dL
BX571963_0 289 EINHRAKNMLAVVQAMVMRT-----ADRSFAESLGARLQALSRNQDL 330

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++W+g ++eL+e++La+ ++ ++R+ ++G++
BX571963_0 331 --LIKRNWSGTPIGELIESQLAAVNDLIGTRVLIEGER 366


Histogram of all scores:
score obs exp (one = represents 16 sequences)
----- --- ---
-14 18 0|==
-13 47 0|===
-12 332 0|=====================
-11 424 39|==*========================
-10 710 497|===============================*=============
-9 924 1232|==========================================================*
-8 839 1279|===================================================== *
-7 586 859|===================================== *
-6 362 469|======================= *
-5 261 232|==============*==
-4 120 110|======*=
-3 77 51|===*=
-2 53 23|=*==
-1 26 10|*=
0 8 4|*
1 6 2|*
2 5 1|*
3 4 0|=
4 1 0|=
> 5 12 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4266.4375
P(chi-square) = 0

Total sequences searched: 4833

Whole sequence top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: