hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: BX897699.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BX897699_1332 CDS_1591881-1592894 126.4 2.6e-43 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BX897699_1332 1/1 141 223 .. 1 85 [] 126.4 2.6e-43
Alignments of top-scoring domains:
BX897699_1332: domain 1 of 1, from 141 to 223: score 126.4, E = 2.6e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN+LA++QSia QT+R ++sl+ f+++F gRL++Ls ++dL
BX897699_1 141 EVSHRSKNLLAIIQSIASQTARYTESLQVFLRKFQGRLHSLSHSQDL 187
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t s+W+gA +reL+ ++ y + eR+ l+G d
BX897699_1 188 --ITASDWRGAQFRELVHSQTLGYVMKETERFSLEGID 223
Histogram of all scores:
score obs exp (one = represents 5 sequences)
----- --- ---
-15 1 0|=
-14 14 0|===
-13 58 0|============
-12 198 0|========================================
-11 203 12|==*======================================
-10 285 153|==============================*==========================
-9 207 380|========================================== *
-8 238 395|================================================ *
-7 115 265|======================= *
-6 68 144|============== *
-5 35 71|======= *
-4 27 34|======*
-3 14 15|==*
-2 11 7|=*=
-1 4 3|*
0 0 1|*
1 3 0|=
> 2 7 -|==
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 3397.4404
P(chi-square) = 0
Total sequences searched: 1612
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K