hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: BX897700.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BX897700_1052 CDS_1304515-1305528 126.3 2.3e-43 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BX897700_1052 1/1 141 223 .. 1 85 [] 126.3 2.3e-43
Alignments of top-scoring domains:
BX897700_1052: domain 1 of 1, from 141 to 223: score 126.3, E = 2.3e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN+LA++QSia QT+R ++sl+ f+++F gRL++Ls ++dL
BX897700_1 141 EVSHRSKNLLAIIQSIASQTARYTESLKVFLRKFQGRLHSLSHSQDL 187
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t s+W+gA +reL+ ++ y + eR+ l+G d
BX897700_1 188 --ITASDWRGAQFRELVHSQALGYLIKETERFSLEGVD 223
Histogram of all scores:
score obs exp (one = represents 4 sequences)
----- --- ---
-14 5 0|==
-13 26 0|=======
-12 132 0|=================================
-11 142 9|==*=================================
-10 213 118|=============================*========================
-9 182 292|============================================== *
-8 182 303|============================================== *
-7 100 203|========================= *
-6 70 111|================== *
-5 39 55|========== *
-4 20 26|===== *
-3 15 12|==*=
-2 7 5|=*
-1 4 2|*
0 3 1|*
1 0 0|
> 2 2 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2127.7917
P(chi-square) = 0
Total sequences searched: 1308
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K