Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Corynebacterium glutamicum ATCC 13032  

Data for BX927147  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: BX927147.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BX927147_0947 CDS_1006299-1007558 85.8 4.1e-25 1
BX927147_1958 CDS_2094974-2093895 76.1 2.8e-22 1
BX927147_2883 CDS_3111360-3109897 60.2 1.4e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BX927147_0947 1/1 230 297 .. 1 70 [] 85.8 4.1e-25
BX927147_1958 1/1 159 224 .. 1 70 [] 76.1 2.8e-22
BX927147_2883 1/1 251 324 .. 1 70 [] 60.2 1.4e-17

Alignments of top-scoring domains:
BX927147_0947: domain 1 of 1, from 230 to 297: score 85.8, E = 4.1e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R A+ELHD++gQ+L+a+++++ela++l+ ++ +++++ +l+e+
BX927147_0 230 ERLRFAQELHDTLGQHLAAMSVKSELALALA--KRGDDRLENELREL 274

relarealaevRrllgdLRpaal<-*
++l r++++e+R++++++R+ l
BX927147_0 275 QKLTRTSMSEMRDVVSGYRTVNL 297

BX927147_1958: domain 1 of 1, from 159 to 224: score 76.1, E = 2.8e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIA E+HD+v+Q+Ls+i + l++a++++ d++ +a +++ +
BX927147_1 159 ERARIAGEIHDTVAQGLSSIQMLLHAAEKRV--DDP--QALSHIRLA 201

relarealaevRrllgdLRpaal<-*
r++ + lae+R+++ +L+p+ l
BX927147_1 202 RQTTADNLAETRQIIAALQPTPL 224

BX927147_2883: domain 1 of 1, from 251 to 324: score 60.2, E = 1.4e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrllds....dkdpeearea
ER+RIA E+HD+v+Q+Ls+i + l++ ++ + + ++k+ e++ +
BX927147_2 251 ERQRIAHEIHDTVAQGLSSIQMLLHVSEQEILVaemeEKPKEAIVKK 297

ldeirelarealaevRrllgdLRpaal<-*
++ +r++a++ l+e+R+++ +L+paal
BX927147_2 298 MRLARQTASDNLSEARAMIAALQPAAL 324


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 17 0|==
-13 65 0|=======
-12 119 34|===*========
-11 171 280|================== *
-10 511 650|==================================================== *
-9 549 738|======================================================= *
-8 438 568|============================================ *
-7 370 357|===================================*=
-6 275 202|====================*=======
-5 253 108|==========*===============
-4 122 56|=====*=======
-3 65 29|==*====
-2 43 14|=*===
-1 17 7|*=
0 20 3|*=
1 6 1|*
2 3 0|=
3 3 0|=
4 2 0|=
5 0 0|
6 1 0|=
> 7 7 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 764.4081
P(chi-square) = 0

Total sequences searched: 3058

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: