Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Pectobacterium atrosepticum SCRI1043  

Data for BX950851  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: BX950851.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
BX950851_2007 CDS_2308011-2306203 79.0 6e-23 1
BX950851_2066 CDS_2377334-2378770 77.9 1.2e-22 1
BX950851_1879 CDS_2152117-2153838 77.7 1.4e-22 1
BX950851_1481 CDS_1741709-1740132 60.1 2.2e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
BX950851_2007 1/1 393 461 .. 1 70 [] 79.0 6e-23
BX950851_2066 1/1 289 356 .. 1 70 [] 77.9 1.2e-22
BX950851_1879 1/1 361 428 .. 1 70 [] 77.7 1.4e-22
BX950851_1481 1/1 314 379 .. 1 70 [] 60.1 2.2e-17

Alignments of top-scoring domains:
BX950851_2007: domain 1 of 1, from 393 to 461: score 79.0, E = 6e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHDs++QsLs +k+q++ ++++ + p++ ++ l e+
BX950851_2 393 ERATIARELHDSIAQSLSCLKIQVSCLQMQG--GDLPPASQQLLMEM 437

relarealaevRrllgdLR.paal<-*
re +++a++++R+ll+++R +
BX950851_2 438 REELNTAYRQLRELLTTFRlKLSE 461

BX950851_2066: domain 1 of 1, from 289 to 356: score 77.9, E = 1.2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER++IA+E+HD++gQ+L+ i++ l+l r+ + +k ++e +++l+ +
BX950851_2 289 ERKHIAQEIHDELGQHLTTIRMSLSLMRMCF--AKKNPEMQAHLQKL 333

relarealaevRrllgdLRpaal<-*
++l +++++ vR++ ++LRp +l
BX950851_2 334 MQLTDQTIQVVRNVSTRLRPNVL 356

BX950851_1879: domain 1 of 1, from 361 to 428: score 77.7, E = 1.4e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHDs++Q Ls +++q+ l++r++ ++++++ar+ ++
BX950851_1 361 ERATIARELHDSLAQVLSYLNIQMTLLKRAV--AEENAQARQIITDF 405

relarealaevRrllgdLRpaal<-*
++++++a++++R+llg++R +
BX950851_1 406 EQALSDAYRQLRELLGTFRLTLQ 428

BX950851_1481: domain 1 of 1, from 314 to 379: score 60.1, E = 2.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IARELHD +gQ+++ai +q+ l+++ + ++d +a+ a+ +i
BX950851_1 314 VRKDIARELHDDIGQNITAIQIQAMLVKHSA--PAD--AAQHAAGQI 356

relarealaevRrllgdLRpaal<-*
el+r+ +R+ll++LRp++l
BX950851_1 357 SELSRRIHHTTRQLLRQLRPPVL 379


Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-14 27 0|==
-13 109 0|========
-12 138 49|===*======
-11 262 409|================== *
-10 711 951|================================================ *
-9 871 1079|==========================================================*
-8 660 832|============================================ *
-7 572 523|==================================*====
-6 381 296|===================*======
-5 324 158|==========*===========
-4 169 82|=====*======
-3 102 42|==*====
-2 55 21|=*==
-1 40 11|*==
0 17 5|*=
1 14 2|*
2 6 1|*
3 3 0|=
4 2 0|=
5 4 0|=
6 0 0|
> 7 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 866.5674
P(chi-square) = 0

Total sequences searched: 4492

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: