hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000009.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000009_1315 CDS_1494553-1493429 92.1 4.4e-27 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000009_1315 1/1 183 250 .. 1 70 [] 92.1 4.4e-27
Alignments of top-scoring domains:
CP000009_1315: domain 1 of 1, from 183 to 250: score 92.1, E = 4.4e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD +g+sL++i++++ela rl+ ++d+++ar++++ei
CP000009_1 183 ERERIARDLHDLLGHSLTVISVKAELADRLF--TSDAPRARQEVAEI 227
relarealaevRrllgdLRpaal<-*
++ar++l+evR++++++ a l
CP000009_1 228 SQIARTSLREVREAVTGMNGASL 250
Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-14 5 0|=
-13 18 0|===
-12 43 27|===*==
-11 82 222|=========== *
-10 254 517|================================ *
-9 438 587|======================================================= *
-8 420 452|===================================================== *
-7 349 284|===================================*========
-6 262 161|====================*============
-5 232 86|==========*==================
-4 127 45|=====*==========
-3 76 23|==*=======
-2 38 11|=*===
-1 32 6|*===
0 26 3|*===
1 11 1|*=
2 5 0|=
3 7 0|=
4 2 0|=
5 0 0|
6 0 0|
7 2 0|=
8 1 0|=
9 0 0|
10 0 0|
> 11 2 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1034.3258
P(chi-square) = 0
Total sequences searched: 2432
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K
