Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

6 accessions found for Gluconobacter oxydans 621H  

Data for CP000009  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000009.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000009_1561 CDS_1773760-1775844 96.9 4.7e-33 1
CP000009_0299 CDS_333593-334972 71.2 2.6e-24 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000009_1561 1/1 507 586 .. 1 85 [] 96.9 4.7e-33
CP000009_0299 1/1 263 343 .. 1 85 [] 71.2 2.6e-24

Alignments of top-scoring domains:
CP000009_1561: domain 1 of 1, from 507 to 586: score 96.9, E = 4.7e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E HR KNtL++VQS+a+Q +R + + + +++F+ RL+ALs+aHdL
CP000009_1 507 EILHRLKNTLSIVQSLAHQGFR-SVDDQGPLTTFTSRLVALSAAHDL 552

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L r++W++ dL+ L++ L P g + R+++sGP
CP000009_1 553 --LMRRNWQSTDLASLVQGVLTPLGV--ENRVQVSGPF 586

CP000009_0299: domain 1 of 1, from 263 to 343: score 71.2, E = 2.6e-24
*->ELnHRVKNtLAvVQSiarQTlRnaaslde.fveaFsgRLqALsraHd
ELnHR+KN LA+ Q+++r T+ ++ +fv ++ R+ + +r++d
CP000009_0 263 ELNHRSKNMLAIFQALIRRTVP---DPTVpFVKVLEERITSIARSQD 306

LVpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L L eW gA+ +++++++ a g+ a+R++++G++
CP000009_0 307 L--LIHGEWTGATVHDVVTSQTAVAGDFPATRLRIEGDP 343


Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-14 2 0|=
-13 27 0|====
-12 151 0|===================
-11 215 19|==*========================
-10 390 251|===============================*=================
-9 455 622|========================================================= *
-8 448 646|======================================================== *
-7 292 434|===================================== *
-6 170 236|====================== *
-5 132 117|==============*==
-4 65 55|======*==
-3 32 25|===*
-2 31 11|=*==
-1 7 5|*
0 7 2|*
1 2 1|*
> 2 6 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2199.2554
P(chi-square) = 0

Total sequences searched: 2432

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: