Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
14 projects found  

1 accessions found for   

Data for CP000027  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000027.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000027_1024 CDS_966975-963670 67.7 4.4e-20 1
CP000027_0420 CDS_406752-405679 56.5 9.1e-17 1
CP000027_0649 CDS_610490-609345 54.0 5e-16 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000027_1024 1/1 895 959 .. 1 70 [] 67.7 4.4e-20
CP000027_0420 1/1 147 214 .. 1 70 [] 56.5 9.1e-17
CP000027_0649 2/2 171 238 .. 1 70 [] 53.9 5.2e-16

Alignments of top-scoring domains:
CP000027_1024: domain 1 of 1, from 895 to 959: score 67.7, E = 4.4e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IARELHD +gQsL+++kl+l+ a+ d++p++ +e l+e+
CP000027_1 895 ERSIIARELHDQIGQSLTVLKLMLDKAK-----DSPPDKTEELLAEA 936

relarealaevRrllgdLRpaal<-*
+ l++e ++ vR++ dLRp l
CP000027_1 937 QPLVSELISSVRNMSLDLRPRML 959

CP000027_0420: domain 1 of 1, from 147 to 214: score 56.5, E = 9.1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI+RELHD+v+ L +++ +++ + ++ ++d + + +ld++
CP000027_0 147 ERKRISRELHDEVAPLLLLLMQKIDNLSKQS--ERDIADCKPQLDAL 191

relarealaevRrllgdLRpaal<-*
r ++eal+ +Rr+++dLRp +l
CP000027_0 192 RSQSEEALESLRRIAQDLRPRIL 214

CP000027_0649: domain 2 of 2, from 171 to 238: score 53.9, E = 5.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ER+RIA+ELHD +Q L +i+ +++ + +p ++ ++l
CP000027_0 171 ERRRIAQELHDDTAQDLIVISRAIDRFV-----TQNPNlgeDNLAEL 212

deirelarealaevRrllgdLRpaal<-*
+e++ +++++l+evRr ++dLRp++l
CP000027_0 213 EELQNHVNRTLSEVRRFAQDLRPSVL 238


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 32 0|======
-13 79 0|==============
-12 81 17|==*===========
-11 117 144|==================== *
-10 296 336|================================================== *
-9 298 381|================================================== *
-8 247 294|========================================== *
-7 155 184|========================== *
-6 109 104|=================*=
-5 66 56|=========*=
-4 44 29|====*===
-3 19 15|==*=
-2 12 7|=*
-1 8 3|*=
0 3 1|*
1 5 1|*
2 2 0|=
3 2 0|=
4 0 0|
5 0 0|
> 6 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 280.9173
P(chi-square) = 0

Total sequences searched: 1580

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: