Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Xanthomonas campestris pv. campestris str. 8004  

Data for CP000050  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000050.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000050_1125 CDS_1389216-1390226 139.4 2.8e-47 1
CP000050_3703 CDS_4448871-4445314 130.4 3.1e-44 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000050_1125 1/1 141 223 .. 1 85 [] 139.4 2.8e-47
CP000050_3703 2/2 989 1072 .. 1 85 [] 129.5 6.5e-44

Alignments of top-scoring domains:
CP000050_1125: domain 1 of 1, from 141 to 223: score 139.4, E = 2.8e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+L +VQS+arQ+l+na+sld+++e++++RL+ALs+aH+
CP000050_1 141 ELNHRVKNSLVMVQSLARQSLKNAESLDDANEKIDARLMALSSAHNT 187

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W +Ad++eL + +++ +++++++R++l+G +
CP000050_1 188 --LTRENWVSADIAELTRDAVELCESHQGQRFELHGSS 223

CP000050_3703: domain 2 of 2, from 989 to 1072: score 129.5, E = 6.5e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+++vVQS+a+QT ++++++def+++F++RL+ALsr+++L
CP000050_3 989 ELQHRTRNLITVVQSVATQTMQSSGTMDEFAGKFEDRLAALSRVQGL 1035

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
L+++e a+A++++Ll++eL++ g+e+d++Ri l+GPd
CP000050_3 1036 --LSQAENAPATIGALLRMELDALGAEpDQRRIILDGPD 1072


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-16 1 0|=
-15 0 0|
-14 12 0|=
-13 55 0|=====
-12 293 0|=======================
-11 439 34|==*===============================
-10 579 441|=================================*===========
-9 750 1093|==========================================================*
-8 737 1135|========================================================= *
-7 558 762|=========================================== *
-6 308 416|======================== *
-5 218 206|===============*=
-4 137 97|=======*===
-3 82 45|===*===
-2 54 20|=*===
-1 20 9|*=
0 11 4|*
1 9 1|*
2 4 0|=
3 3 0|=
> 4 3 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 5159.1157
P(chi-square) = 0

Total sequences searched: 4273

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: