Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

3 accessions found for Pseudomonas syringae pv. phaseolicola 1448A  

Data for CP000058  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000058.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000058_1822 CDS_2213944-2212895 74.9 1.1e-21 1
CP000058_0626 CDS_758095-760107 67.0 2.3e-19 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000058_1822 1/1 144 211 .. 1 70 [] 74.9 1.1e-21
CP000058_0626 1/1 466 533 .. 1 70 [] 67.0 2.3e-19

Alignments of top-scoring domains:
CP000058_1822: domain 1 of 1, from 144 to 211: score 74.9, E = 1.1e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A +LHD+++Q+L+++ l++ + + ++ pe++++ l++i
CP000058_1 144 ERKRMAYDLHDGLAQTLAGLHQRLQGFAGRC--PELPEPLDADLQAI 188

relarealaevRrllgdLRpaal<-*
+la+++ e R+l+g+LRp++l
CP000058_1 189 LKLAQHCVGEGRQLIGGLRPSVL 211

CP000058_0626: domain 1 of 1, from 466 to 533: score 67.0, E = 2.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E aRIARE HD++gQ+L+++kl +++++ ++ ++ ++ + e+ld +
CP000058_0 466 EKARIAREVHDELGQMLTVLKLETSMCELAY--ADLDPGLGERLDSM 510

relarealaevRrllgdLRpaal<-*
++l+ + + vR+++++LRp++l
CP000058_0 511 KRLIAQLFQLVRDVATALRPPIL 533


Histogram of all scores:
score obs exp (one = represents 16 sequences)
----- --- ---
-14 18 0|==
-13 61 0|====
-12 121 55|===*====
-11 230 456|=============== *
-10 631 1059|======================================== *
-9 927 1203|==========================================================*
-8 738 927|=============================================== *
-7 644 583|====================================*====
-6 506 330|====================*===========
-5 464 177|===========*=================
-4 240 92|=====*=========
-3 168 47|==*========
-2 88 24|=*====
-1 64 12|*===
0 34 6|*==
1 21 3|*=
2 7 1|*
3 6 0|=
4 6 0|=
5 2 0|=
6 2 0|=
7 0 0|
8 1 0|=
9 1 0|=
> 10 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2076.4575
P(chi-square) = 0

Total sequences searched: 4984

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: