Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Colwellia psychrerythraea 34H  

Data for CP000083  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000083.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000083_1366 CDS_1444373-1445824 54.7 9.4e-16 1
CP000083_1222 CDS_1294285-1292882 42.5 3.6e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000083_1366 1/1 260 327 .. 1 70 [] 54.7 9.4e-16
CP000083_1222 1/1 251 317 .. 1 70 [] 42.5 3.6e-12

Alignments of top-scoring domains:
CP000083_1366: domain 1 of 1, from 260 to 327: score 54.7, E = 9.4e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E ++IARELHD++ Q L +ik le+ +++l k+ +e+ + l+ +
CP000083_1 260 ENRHIARELHDGIIQILVSIKFSLEATKMHL--SKAVQEVPKPLQHA 304

relarealaevRrllgdLRpaal<-*
++ + a++e+Rr+ ++++p++l
CP000083_1 305 EDNLVIAIDEIRRISHHMHPQIL 327

CP000083_1222: domain 1 of 1, from 251 to 317: score 42.5, E = 3.6e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +R +RELHD+++Q+++a++ le+a+ l + +++ a ++++
CP000083_1 251 ECKRVSRELHDGISQTIAAARFSLETAQ-LK--HQNNDDASNEMERS 294

relarealaevRrllgdLRpaal<-*
+el+ + + ++R++ ++L+p+ l
CP000083_1 295 MELICKIMGDIRAISHQLHPGLL 317


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-16 1 0|=
-15 17 0|=
-14 175 0|===========
-13 321 0|===================
-12 341 54|===*=================
-11 421 450|========================= *
-10 961 1044|========================================================= *
-9 929 1185|======================================================= *
-8 662 913|======================================= *
-7 456 574|=========================== *
-6 239 325|=============== *
-5 189 174|==========*=
-4 92 91|=====*
-3 45 46|==*
-2 22 23|=*
-1 14 12|*
0 8 6|*
1 6 3|*
2 4 1|*
3 1 0|=
4 2 0|=
> 5 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1676.0929
P(chi-square) = 0

Total sequences searched: 4910

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: