Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

2 accessions found for Burkholderia thailandensis E264  

Data for CP000086  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000086.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000086_2834 CDS_3316977-3314755 59.2 2.9e-17 1
CP000086_1821 CDS_2084978-2083044 56.8 1.5e-16 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000086_2834 1/1 531 594 .. 1 70 [] 59.2 2.9e-17
CP000086_1821 1/1 439 507 .. 1 70 [] 56.8 1.5e-16

Alignments of top-scoring domains:
CP000086_2834: domain 1 of 1, from 531 to 594: score 59.2, E = 2.9e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+++Q+L++++l le++ + e++ +++e+
CP000086_2 531 ERGRIARELHDELAQTLAMLRLDLERVSTTG--N----ELAGRFTEM 571

relarealaevRrllgdLRpaal<-*
r+l++ a a +Rr+++dLRp l
CP000086_2 572 RGLLDGAVAATRRIASDLRPLML 594

CP000086_1821: domain 1 of 1, from 439 to 507: score 56.8, E = 1.5e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ A+ LHDs++QsL ++lq++++ ++ +++ + ar+ + ++
CP000086_1 439 ERNLVAQGLHDSIAQSLNFVNLQTQMLGDAIS-HDNLADARDIVPML 484

relarealaevRrllgdLRpaal<-*
++ +++++a+vR+ll ++R+
CP000086_1 485 KHGVEQSYADVRELLLNFRTRLT 507


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 9 0|=
-13 33 0|====
-12 59 36|===*==
-11 119 300|============ *
-10 337 696|================================== *
-9 532 791|====================================================== *
-8 490 609|================================================= *
-7 464 383|======================================*========
-6 373 216|=====================*================
-5 371 116|===========*==========================
-4 193 60|=====*==============
-3 110 31|===*=======
-2 69 15|=*=====
-1 40 8|*===
0 24 4|*==
1 18 2|*=
2 12 1|*=
3 9 0|=
4 4 0|=
5 2 0|=
6 2 0|=
7 1 0|=
8 1 0|=
9 0 0|
> 10 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1891.4047
P(chi-square) = 0

Total sequences searched: 3276

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: