Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

1 accessions found for Dechloromonas aromatica RCB  

Data for CP000089  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000089.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000089_1389 CDS_1527460-1529511 73.6 2.1e-21 1
CP000089_0830 CDS_904633-906573 70.5 1.8e-20 1
CP000089_1563 CDS_1687559-1686438 66.8 2.3e-19 1
CP000089_1026 CDS_1129889-1131277 55.3 5.4e-16 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000089_1389 1/1 481 548 .. 1 70 [] 73.6 2.1e-21
CP000089_0830 1/1 440 508 .. 1 70 [] 70.5 1.8e-20
CP000089_1563 1/1 174 241 .. 1 70 [] 66.8 2.3e-19
CP000089_1026 1/1 256 322 .. 1 70 [] 55.3 5.4e-16

Alignments of top-scoring domains:
CP000089_1389: domain 1 of 1, from 481 to 548: score 73.6, E = 2.1e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RI+RELHD++gQ+L+++++ ++++ +l + +e+++ + i
CP000089_1 481 ERLRISRELHDELGQALTGLRMEISWLGGRL--LTTQPELEQKVVSI 525

relarealaevRrllgdLRpaal<-*
++l++ +++ vRr+ ++LRp +l
CP000089_1 526 KKLIDGTIKSVRRISSELRPLVL 548

CP000089_0830: domain 1 of 1, from 440 to 508: score 70.5, E = 1.8e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+ +A+ELHDs++Q+L+ +++q++l++ l +k ++ea +++ +
CP000089_0 440 ERNLLAQELHDSIAQGLAFLNIQVQLLQDSL--RKGKAdEAMQTAGQ 484

irelarealaevRrllgdLRpaal<-*
+re ++e++++vR+ll ++R+ ++
CP000089_0 485 LREGVQESYDDVRELLVHFRTRVH 508

CP000089_1563: domain 1 of 1, from 174 to 241: score 66.8, E = 2.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHD++gQ+L+a+++ l ++ r+ ++ +e+++++d+
CP000089_1 174 ERTAIARELHDELGQALTALRIDLAWINRQC--KTLGPEVQARADAS 218

relarealaevRrllgdLRpaal<-*
++++++++ vRr+ +LRp+ l
CP000089_1 219 CAIVERTIDAVRRISEGLRPGML 241

CP000089_1026: domain 1 of 1, from 256 to 322: score 55.3, E = 5.4e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHD+++Q+++a++ ++++ +++ +++p+ ++ i
CP000089_1 256 ERQVIARELHDELAQGITAVRALAGAIVQRT--PDEPALHI-PAQSI 299

relarealaevRrllgdLRpaal<-*
+ e ++ vR++l++LRp++
CP000089_1 300 VAVTGEMQDGVRNILHRLRPPVG 322


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 11 0|=
-13 51 0|====
-12 115 46|===*=====
-11 208 382|================ *
-10 541 887|========================================== *
-9 746 1007|==========================================================*
-8 653 776|=================================================== *
-7 543 488|=====================================*====
-6 450 276|=====================*=============
-5 365 148|===========*=================
-4 170 77|=====*========
-3 117 39|==*======
-2 81 20|=*=====
-1 41 10|*===
0 25 5|*=
1 15 2|*=
2 11 1|*
3 7 0|=
4 5 0|=
5 2 0|=
6 2 0|=
7 5 0|=
8 0 0|
> 9 7 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1442.0498
P(chi-square) = 0

Total sequences searched: 4171

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: