Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

4 accessions found for Ralstonia eutropha JMP134  

Data for CP000090  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000090.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000090_0123 CDS_151488-150088 64.8 7.2e-19 1
CP000090_3394 CDS_3750701-3752146 62.0 4.7e-18 1
CP000090_1204 CDS_1300675-1302222 58.8 4e-17 1
CP000090_1769 CDS_1950260-1948821 50.2 1.4e-14 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000090_0123 1/1 249 316 .. 1 70 [] 64.8 7.2e-19
CP000090_3394 1/1 262 332 .. 1 70 [] 62.0 4.7e-18
CP000090_1204 1/1 312 381 .. 1 70 [] 58.8 4e-17
CP000090_1769 1/1 229 295 .. 1 70 [] 50.2 1.4e-14

Alignments of top-scoring domains:
CP000090_0123: domain 1 of 1, from 249 to 316: score 64.8, E = 7.2e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +R+ARELHD++g L+aikl l+++rr++ ++ +ea+e l ++
CP000090_0 249 EKTRLARELHDELGAILTAIKLDLHWVRRRV--QESQPEAAEKLSRV 293

relarealaevRrllgdLRpaal<-*
+ +++++++ Rrl+ dLRp++l
CP000090_0 294 MLHVDQGIQIKRRLIEDLRPTVL 316

CP000090_3394: domain 1 of 1, from 262 to 332: score 62.0, E = 4.7e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ERaR++RELHD+++Q L ++kl le+a+ +l + +p+++ +++ l
CP000090_3 262 ERARLSRELHDGISQLLVSVKLVLEAAANRL--RLAPAegaAVAPVL 306

deirelarealaevRrllgdLRpaal<-*
++ +++ +evRr++++LRpa l
CP000090_3 307 GMALNRLDTVFNEVRRVARNLRPALL 332

CP000090_1204: domain 1 of 1, from 312 to 381: score 58.8, E = 4e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
E +RIARELHD +gQ+Lsa+k+ + ++++ + + + + + + ++
CP000090_1 312 EKRRIARELHDDLGQRLSALKMDMTMLAADV--SESRDirGILADIT 356

eirelarealaevRrllgdLRpaal<-*
+ + ++++ a vRr+++dLRpa l
CP000090_1 357 DMNGVIDDTVASVRRIASDLRPALL 381

CP000090_1769: domain 1 of 1, from 229 to 295: score 50.2, E = 1.4e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD+ gQ L+a++ + + r + +p +++ + +
CP000090_1 229 ERARLARELHDEFGQVLTAMRADATYLVRKS--AHAP-MLQIVANDL 272

relarealaevRrllgdLRpaal<-*
++++ + ++evR+ll++LRp +
CP000090_1 273 AGHCARIQDEVRHLLHRLRPHGG 295


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 5 0|=
-13 23 0|===
-12 85 38|===*====
-11 130 315|============ *
-10 375 731|=================================== *
-9 595 830|======================================================= *
-8 544 640|================================================== *
-7 484 402|====================================*=======
-6 402 227|====================*================
-5 325 122|===========*==================
-4 188 63|=====*============
-3 89 32|==*======
-2 75 16|=*=====
-1 39 8|*===
0 27 4|*==
1 18 2|*=
2 13 1|*=
3 4 0|=
4 4 0|=
5 3 0|=
6 2 0|=
7 1 0|=
8 2 0|=
9 1 0|=
10 0 0|
11 0 0|
> 12 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1556.4800
P(chi-square) = 0

Total sequences searched: 3439

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: