Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

4 accessions found for Ralstonia eutropha JMP134  

Data for CP000091  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000091.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000091_1592 CDS_1804512-1806539 66.4 1.7e-19 1
CP000091_1976 CDS_2245390-2243720 33.8 6.8e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000091_1592 1/1 449 517 .. 1 70 [] 66.4 1.7e-19
CP000091_1976 1/1 352 415 .. 5 70 .] 33.8 6.8e-10

Alignments of top-scoring domains:
CP000091_1592: domain 1 of 1, from 449 to 517: score 66.4, E = 1.7e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ A+ LHDs++Q+L ++lq++l+ ++d ++d +eare + ++
CP000091_1 449 ERNLVAQGLHDSIAQGLNFLNLQVQLLGDAVD-RDDLAEAREIVPML 494

relarealaevRrllgdLRpaal<-*
r+ ++e++++vR+ll ++R
CP000091_1 495 RHGVEESYQDVRELLNNFRSRLT 517

CP000091_1976: domain 1 of 1, from 352 to 415: score 33.8, E = 6.8e-10
*->IARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeirela
I RELHD++gQ+L+++ + + l +k+ +a++ +++i el+
CP000091_1 352 IGRELHDGLGQHLTSLGFYCASLSQEL--QKHRHPAAADAATIVELV 396

realaevRrllgdLRpaal<-*
r+a +R ++++L p al
CP000091_1 397 RQASLMARKIAHGLDPIAL 415


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-14 1 0|=
-13 20 0|===
-12 57 26|===*=====
-11 91 220|============= *
-10 255 511|===================================== *
-9 391 581|======================================================== *
-8 372 447|====================================================== *
-7 343 281|========================================*========
-6 278 159|======================*=================
-5 252 85|============*=======================
-4 138 44|======*=============
-3 85 22|===*=========
-2 43 11|=*=====
-1 37 5|*=====
0 14 3|*=
1 15 1|*==
2 1 0|=
3 4 0|=
4 2 0|=
5 3 0|=
> 6 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1347.4747
P(chi-square) = 0

Total sequences searched: 2407

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: