Crenarchaeota Euryarchaeota Nanoarchaeota
Other Archaea
Classification of phyla is from NCBI page
Search:
82 projects found  

2 accessions found for Methanosarcina barkeri str. Fusaro  

Data for CP000099  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000099.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000099_2590 CDS_3395912-3393252 205.1 6.4e-59 1
CP000099_2935 CDS_3915423-3911554 199.5 3.1e-57 1
CP000099_2510 CDS_3278659-3280632 197.8 1e-56 1
CP000099_2601 CDS_3413171-3410769 197.3 1.5e-56 1
CP000099_0393 CDS_482832-479284 196.6 2.3e-56 1
CP000099_1444 CDS_1831201-1833315 196.0 3.6e-56 1
CP000099_1889 CDS_2426018-2429764 190.9 1.2e-54 1
CP000099_2471 CDS_3222973-3220514 190.2 2.1e-54 1
CP000099_1616 CDS_2054203-2057040 189.7 2.8e-54 1
CP000099_1491 CDS_1893595-1895643 188.2 8.2e-54 1
CP000099_2782 CDS_3688114-3685304 183.7 1.9e-52 1
CP000099_3413 CDS_4540502-4538238 178.7 5.6e-51 1
CP000099_3326 CDS_4417461-4421093 177.1 1.7e-50 1
CP000099_2836 CDS_3766972-3764294 174.9 8.1e-50 1
CP000099_0798 CDS_990354-987598 174.4 1.2e-49 1
CP000099_2289 CDS_2987835-2989184 173.3 2.5e-49 1
CP000099_2934 CDS_3911227-3908084 171.4 8.9e-49 1
CP000099_3134 CDS_4168518-4166278 168.6 6.3e-48 1
CP000099_2118 CDS_2767040-2769070 167.9 1e-47 1
CP000099_2811 CDS_3722628-3724106 156.7 2e-44 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000099_2590 1/1 660 754 .. 1 94 [] 205.1 6.4e-59
CP000099_2935 1/1 1060 1154 .. 1 94 [] 199.5 3.1e-57
CP000099_2510 1/1 435 529 .. 1 94 [] 197.8 1e-56
CP000099_2601 1/1 574 668 .. 1 94 [] 197.3 1.5e-56
CP000099_0393 1/1 975 1063 .. 1 94 [] 196.6 2.3e-56
CP000099_1444 1/1 486 578 .. 1 94 [] 196.0 3.6e-56
CP000099_1889 1/1 1034 1120 .. 1 94 [] 190.9 1.2e-54
CP000099_2471 1/1 602 696 .. 1 94 [] 190.2 2.1e-54
CP000099_1616 1/1 738 826 .. 1 94 [] 189.7 2.8e-54
CP000099_1491 1/1 458 544 .. 1 94 [] 188.2 8.2e-54
CP000099_2782 1/1 716 810 .. 1 94 [] 183.7 1.9e-52
CP000099_3413 1/1 535 623 .. 1 94 [] 178.7 5.6e-51
CP000099_3326 1/1 994 1077 .. 1 94 [] 177.1 1.7e-50
CP000099_2836 1/1 682 770 .. 1 94 [] 174.9 8.1e-50
CP000099_0798 1/1 704 792 .. 1 94 [] 174.4 1.2e-49
CP000099_2289 1/1 233 321 .. 1 94 [] 173.3 2.5e-49
CP000099_2934 1/1 835 928 .. 1 94 [] 171.4 8.9e-49
CP000099_3134 1/1 526 616 .. 1 94 [] 168.6 6.3e-48
CP000099_2118 1/1 465 553 .. 1 94 [] 167.9 1e-47
CP000099_2811 1/1 278 371 .. 1 94 [] 156.7 2e-44

Alignments of top-scoring domains:
CP000099_2590: domain 1 of 1, from 660 to 754: score 205.1, E = 6.4e-59
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa++f+++e ikd+EVlea+rEsq+RV
CP000099_2 660 EIHHRIKNNLQVISSLLDLQAEQFRNRENIKDsEVLEAFRESQDRVV 706

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeLYk+++l+t++fs+Y+++L+enLf++y++g+++isL+ Dl
CP000099_2 707 SMALIHEELYKGGGLETLNFSPYIRELVENLFHTYSLGDIDISLSMDL 754

*

CP000099_2 - -

CP000099_2935: domain 1 of 1, from 1060 to 1154: score 199.5, E = 3.1e-57
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa++f ++e ikd+EVl+a+rEsq+RV+
CP000099_2 1060 EIHHRIKNNLQVISSLLDLQAENFNNREDIKDsEVLKAFRESQDRVI 1106

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeLYk++++dt++fs+Y+e+L+enL+++y++g+ +isL+ Dl
CP000099_2 1107 SMALIHEELYKGGGFDTLNFSSYIEELAENLLKTYRLGNADISLDMDL 1154

*

CP000099_2 - -

CP000099_2510: domain 1 of 1, from 435 to 529: score 197.8, E = 1e-56
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHRVKNNLQvISSLL+LQa+kf +e+ikd+EVl+a+rEsqnRV
CP000099_2 435 EIHHRVKNNLQVISSLLDLQAEKFNKRECIKDsEVLKAFRESQNRVV 481

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S+AliHEeLY++ ++d+vdfs Yl+kL+en fq+y++g+ +isLk Dl
CP000099_2 482 SIALIHEELYEGAETDKVDFSLYLQKLVENFFQTYRLGNLDISLKTDL 529

*

CP000099_2 - -

CP000099_2601: domain 1 of 1, from 574 to 668: score 197.3, E = 1.5e-56
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa++f+++e ikd+EVlea+rEsq+RV+
CP000099_2 574 EIHHRIKNNLQVISSLLDLQAEQFRNREDIKDsEVLEAFRESQDRVI 620

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeLY++++++t++fs+Y+++L+enL+ +y++g ++sL+ D+
CP000099_2 621 SMALIHEELYRGGGFETLNFSPYIQELAENLLLTYRLGITDVSLSMDM 668

*

CP000099_2 - -

CP000099_0393: domain 1 of 1, from 975 to 1063: score 196.6, E = 2.3e-56
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kf ++ v +ea+rEsqnRV+S
CP000099_0 975 EIHHRIKNNLQVISSLLDLQADKFNNPRV-----IEAFRESQNRVIS 1016

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeLYk+e++dt+dfs Y+++L+enLfq+y+++s++i+L+ Dl
CP000099_0 1017 MALIHEELYKGEGTDTLDFSTYIRELAENLFQTYSLKSKNIHLSMDL 1063

CP000099_1444: domain 1 of 1, from 486 to 578: score 196.0, E = 3.6e-56
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQ++ f ++e++k++EV ea+rEsq+RV+
CP000099_1 486 EIHHRIKNNLQVISSLLDLQSETFFNREICKTqEVVEAFRESQDRVA 532

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeLYk++++dt+df++Yl+kLte+Lf+sy +g++ i+Lk l
CP000099_1 533 SMALIHEELYKGDNIDTLDFAAYLNKLTEDLFNSYDLGNKSIRLK--L 578

*

CP000099_1 - -

CP000099_1889: domain 1 of 1, from 1034 to 1120: score 190.9, E = 1.2e-54
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kf+++ v +ea+rEsqnRV+S
CP000099_1 1034 EIHHRIKNNLQVISSLLDLQADKFDNPRV-----IEAFRESQNRVIS 1075

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeLYk+e+++t+dfs+Y+++L+enLfq+y++++++ Lk +
CP000099_1 1076 MALIHEELYKGEETETLDFSAYIRELAENLFQTYSLSNKNTLLK--M 1120

CP000099_2471: domain 1 of 1, from 602 to 696: score 190.2, E = 2.1e-54
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kf + e+++++EVlea+rEsq+RVl
CP000099_2 602 EIHHRIKNNLQVISSLLDLQAEKFNNMECVTNsEVLEAFRESQDRVL 648

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S++liHEeL+++e++++++fs+Yl+kL++nLfq+y++g+ isLk +l
CP000099_2 649 SISLIHEELHEGEGTEKLNFSPYLKKLIGNLFQTYRLGDAAISLKTEL 696

*

CP000099_2 - -

CP000099_1616: domain 1 of 1, from 738 to 826: score 189.7, E = 2.8e-54
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kf++ +v +ea+rEsqnRV+S
CP000099_1 738 EIHHRIKNNLQVISSLLDLQAEKFDNLNV-----IEAFRESQNRVIS 779

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeLYk+e++dtv+fseYl+kL+enLfq+y++ s+++ L Dl
CP000099_1 780 MALIHEELYKGEGTDTVNFSEYLKKLAENLFQTYRLYSKNLGLFTDL 826

CP000099_1491: domain 1 of 1, from 458 to 544: score 188.2, E = 8.2e-54
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHR+KNNLQvISSLL+LQa+kf+d+ev lea+rEsqnRV S
CP000099_1 458 EVHHRIKNNLQVISSLLSLQAEKFEDKEV-----LEAFRESQNRVES 499

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A+iHE+L++se++d dfs+Yl+kLt +Lf+sy+vg+ +isLk l
CP000099_1 500 IAMIHERLHESENMDAFDFSDYLRKLTTDLFNSYNVGNRNISLK--L 544

CP000099_2782: domain 1 of 1, from 716 to 810: score 183.7, E = 1.9e-52
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kf+++e+++++EVl+a+rEsq+RV+
CP000099_2 716 EIHHRIKNNLQVISSLLDLQAEKFRSRECTENeEVLNAFRESQDRVM 762

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S+AliH+eL++++ +dt+++s+Yle+L+enLfq+y+vg+ + sLkl++
CP000099_2 763 SIALIHKELHEGKVTDTLNISAYLERLVENLFQTYRVGNVNTSLKLEV 810

*

CP000099_2 - -

CP000099_3413: domain 1 of 1, from 535 to 623: score 178.7, E = 5.6e-51
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kfkde v ++a+ EsqnRV S
CP000099_3 535 EIHHRIKNNLQVISSLLDLQADKFKDESV-----RKAFSESQNRVFS 576

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liHEeLYk+++ ++dfs+YlekL+enLf++y+ +++ i+L+ Dl
CP000099_3 577 MSLIHEELYKGDEACSLDFSSYLEKLAENLFRTYSTSGKSIHLNTDL 623

CP000099_3326: domain 1 of 1, from 994 to 1077: score 177.1, E = 1.7e-50
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL LQa+kf+++ev lea+rEsqnRV++
CP000099_3 994 EIHHRIKNNLQVISSLLELQAEKFSEKEV-----LEAFRESQNRVAT 1035

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA+iHEeLY+s++ + +dfseYl+kLt++L++sy+vg+d ++ +
CP000099_3 1036 MAIIHEELYRSRNSEVLDFSEYLQKLTADLLRSYSVGGD---VR--M 1077

CP000099_2836: domain 1 of 1, from 682 to 770: score 174.9, E = 8.1e-50
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHR+KNNLQ++SS+L+LQa+kfkd+ev +ea+rEs+nRV+S
CP000099_2 682 ETHHRIKNNLQIVSSMLSLQADKFKDKEV-----IEAFRESENRVIS 723

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m++iHEeLYksed+ ++df++Yl+kLt+++++sy+ g+++++L l++
CP000099_2 724 MSIIHEELYKSEDVASIDFAAYLRKLTADILHSYRIGNEKVKLILEV 770

CP000099_0798: domain 1 of 1, from 704 to 792: score 174.4, E = 1.2e-49
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kf+d++v + a+ EsqnRV S
CP000099_0 704 EIHHRIKNNLQVISSLLDLQAEKFEDKKV-----KQAFSESQNRVFS 745

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liHEeLYk++ ++++fs+YlekL++nL+ +y++++++i+L+ Dl
CP000099_0 746 MSLIHEELYKGGQAEKLNFSAYLEKLADNLLMTYRLSRINIRLNMDL 792

CP000099_2289: domain 1 of 1, from 233 to 321: score 173.3, E = 2.5e-49
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR KNNLQvISSLL+L+a++++d + lea+rEsqnRV S
CP000099_2 233 EIHHRTKNNLQVISSLLSLEADRSTDAKM-----LEAFRESQNRVTS 274

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeLYk++++ ++df++Yl+kLt+nLf+sy+++++ isLkl+l
CP000099_2 275 MALIHEELYKGDEVNNLDFADYLQKLTNNLFHSYRLRNEEISLKLEL 321

CP000099_2934: domain 1 of 1, from 835 to 928: score 171.4, E = 8.9e-49
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
E HHR+KNNLQvISSLL+LQa+ fk++++i+d+EV +a++Es++RVl
CP000099_2 835 ELHHRIKNNLQVISSLLDLQADLFKGRKTITDsEVSKAFKESIDRVL 881

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S+AliHEeLYk++++d +dfs+Y+++L++nL+ +y+++ d +sL++Dl
CP000099_2 882 SIALIHEELYKGKNIDLLDFSQYIKELANNLLLTYSLKTD-VSLNFDL 928

*

CP000099_2 - -

CP000099_3134: domain 1 of 1, from 526 to 616: score 168.6, E = 6.3e-48
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kf e+ +++ Vl+a+r+sqnRV+
CP000099_3 526 EIHHRIKNNLQVISSLLDLQAEKFAVNEIYDTsRVLAAFRDSQNRVI 572

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeLY s++++t++f+ Yl+kLte+Lf++y+vg + ++ +
CP000099_3 573 SMALIHEELYGSKEISTLNFATYLQKLTEELFRCYNVGVSEVK----M 616

*

CP000099_3 - -

CP000099_2118: domain 1 of 1, from 465 to 553: score 167.9, E = 1e-47
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kf d +v ea+rEsqnRV S
CP000099_2 465 EIHHRIKNNLQVISSLLDLQADKFNDMKV-----VEAFRESQNRVVS 506

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeL+++++++ ++ s Yle+L+enLfq+y+ ++ +i+L+ Dl
CP000099_2 507 MALIHEELHEGRGIEVLNSSRYLERLVENLFQTYRSENADIRLNMDL 553

CP000099_2811: domain 1 of 1, from 278 to 371: score 156.7, E = 2e-44
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL L++++ + + + ++V+ea+rEs nR++
CP000099_2 278 EIHHRIKNNLQVISSLLELECENLLSGNL-EReKVIEAFRESNNRII 323

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
Sm++iHE+LY s++++t++f++Yl++Lt++Lf+sy vgs++i+L lD+
CP000099_2 324 SMSIIHEKLYNSKNMETINFASYLKELTDDLFKSYKVGSSDIQLLLDV 371

*

CP000099_2 - -


Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-15 7 0|=
-14 9 0|=
-13 36 22|=*=
-12 164 236|=========== *
-11 852 659|===========================================*=============
-10 667 853|============================================= *
-9 704 721|=============================================== *
-8 449 483|============================== *
-7 279 287|===================*
-6 234 160|==========*=====
-5 80 86|=====*
-4 43 45|==*
-3 30 23|=*
-2 16 12|*=
-1 11 6|*
0 2 3|*
1 0 1|*
2 2 0|=
> 3 22 -|==


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 170.8440
P(chi-square) = 3.208e-30

Total sequences searched: 3607

Whole sequence top hits:
tophits_s report:
Total hits: 20
Satisfying E cutoff: 20
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 20
Satisfying E cutoff: 20
Total memory: 29K


Acknowledgements:

This research is funded by:

Developed by: